KEGG   Mycobacterium sp. JLS: Mjls_2446Help
Entry
Mjls_2446         CDS       T00482                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mjl  Mycobacterium sp. JLS
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mjls_2446 (tpiA)
   01230 Biosynthesis of amino acids
    Mjls_2446 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mjls_2446 (tpiA)
   00051 Fructose and mannose metabolism
    Mjls_2446 (tpiA)
   00562 Inositol phosphate metabolism
    Mjls_2446 (tpiA)
Enzymes [BR:mjl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mjls_2446 (tpiA)
Exosome [BR:mjl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mjls_2446 (tpiA)
  Exosomal proteins of bladder cancer cells
   Mjls_2446 (tpiA)
  Exosomal proteins of melanoma cells
   Mjls_2446 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2557693..2558478
Genome map
AA seq 261 aa AA seqDB search
MARKPLIAGNWKMNLNHFEAIALVQKIAFSLPDKYFDKVDVTVIPPFTDLRSVQTLVDGD
KLRLSYGAQDVSQHDSGAYTGEISGAFLAKLGCSFAVVGHSERRTYHHEDDALVAAKAAA
AFRHGITPIVCIGEHLKVREAGNHVEHNVEQLRGSLAGLTSEQIGQAVIAYEPVWAIGTG
RVAGAADAQEVCKAIRDELGKLSSPQLAAGIRVLYGGSVNAKNVGEIVAQEDVDGALVGG
ASLDGEQFATLSAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtaagccgctgatcgccggcaactggaagatgaacctcaaccacttcgaggcc
atcgcgctggtgcagaagatcgccttctcgctgccggacaagtacttcgacaaggtcgac
gtgacggtcatcccgccgttcaccgacctgcgcagcgtgcagacgctcgtcgacggggac
aaactgcgcctgagctacggcgcgcaggacgtttcgcagcacgattccggtgcctacacc
ggcgagatcagcggcgcgttcctggccaagctgggctgttcgttcgccgtcgtggggcac
tcggagcgccgcacctaccaccacgaggacgacgcgctggtggccgccaaggccgccgcg
gcgttccggcacggcatcaccccgatcgtctgcatcggtgagcacctgaaggtgcgtgag
gcgggcaaccacgtcgagcacaacgtcgagcagttgcgtggttcgctggcggggctgacg
tccgagcagatcggtcaggccgtcatcgcctacgaacccgtgtgggcgatcggcaccggc
cgggtggccggcgccgccgacgcgcaggaggtgtgcaaggccatccgcgacgagctcggg
aagctctcctcaccgcagctggcggccgggatcagggtgctctacggcgggtcggtgaac
gccaagaacgtcggggagatcgtggcccaggaagacgtcgacggtgcgctggtcggtggg
gcctccctggacggtgagcagttcgccacgctgtcggcgatcgccgccggcgggcccctg
ccctga

DBGET integrated database retrieval system