KEGG   Mycobacterium sp. JLS: Mjls_3065Help
Entry
Mjls_3065         CDS       T00482                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mjl  Mycobacterium sp. JLS
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mjls_3065
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mjls_3065
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mjls_3065
Enzymes [BR:mjl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mjls_3065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
complement(3206385..3207173)
Genome map
AA seq 262 aa AA seqDB search
MSRLGGLFHACRAERRAALIGYLPTGFPDVPASISAMTALVESGCDIIEVGIPYSDPGMD
GPVIAAATEAALQGGVRVRDTLTAVEAISNAGGRAVVMTYWNPVLRWGIDAFARDLAAAG
GLGLITPDLIPEEADEWMAASDAHDLDRIFLVAPASTPERLAKTVQATRGFVYAASTMGV
TGARDAVSSAAPELVARVKEVSDIPVGVGLGVRSREQAAEIGAYADGVIVGSALVSALKD
GVPAVRALTEELAEGVRQRVTA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagtcggttgggtggcttgttccacgcttgccgagcggagcgacgcgcggcgctcatc
ggatacctgccaaccggattccccgacgtgccggcatcgatctcggcgatgacagcgttg
gtcgaatccggttgcgacatcatcgaagtcggcatcccgtactccgacccggggatggac
ggcccggtcatcgccgccgccaccgaggcggcgctgcagggcggcgtccgagtgcgcgac
accctgacggcggtcgaggccatcagcaacgccggcgggcgcgcagtggtgatgacgtac
tggaatcccgtgctgcggtgggggatcgacgccttcgcgagggatctcgccgccgcgggt
ggactgggtctgatcacccctgatctcattcccgaagaggccgacgagtggatggcggct
tccgacgcccacgatctggaccggatcttcctggtggccccggcgtcgacgcccgagcgg
ctggccaagacggtccaggcgacacgggggttcgtctacgcggcatcgacgatgggcgtc
accggcgcccgtgacgccgtctcgagtgccgctcccgaactcgtcgcgcgcgtcaaggag
gtctccgacatcccggtcggcgtcggcctcggtgtgcggtcgcgggagcaggcggccgag
atcggcgcgtacgccgacggcgtgatcgtcggatcggcgctcgtgtcggcgctcaaggac
ggggtgcccgcggtgcgcgcgctgaccgaggaactagctgagggagtccgccagagggtg
accgcgtga

DBGET integrated database retrieval system