KEGG   Mycobacterium sp. JLS: Mjls_3066Help
Entry
Mjls_3066         CDS       T00482                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mjl  Mycobacterium sp. JLS
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mjls_3066
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mjls_3066
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mjls_3066
Enzymes [BR:mjl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mjls_3066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
complement(3207170..3208432)
Genome map
AA seq 420 aa AA seqDB search
MAELVDSDLPRSSAAVAEPTSHDPDARGHFGPYGGRLVPEALMAVIEEVTAAYEKARGDQ
TFLDELDRLQRHYSGRPSPLYEATRLSEHAGGARIFLKREDLNHTGSHKINNVLGQALLA
RQMGKTRVIAETGAGQHGVATATACALLGLDCVIYMGAVDTARQALNVARMRLLGAEVVS
VEAGSKTLKDAINEAFRDWVTNADETYYCFGTAAGPHPFPLMVRDFQRIIGLEARAQIQA
QAGRLPDAVTACVGGGSNAIGVFHAFIDDPGVRLIGYEAAGDGVETGRHAATFTGGSPGA
FQGSFSYLLQDEDGQTIESHSISAGLDYPGVGPEHALLKDIGRAEYRPITDTEAMDAFSL
LCRTEGIIPAIESAHAVAGALKLGPELGPGSVILVNLSGRGDKDVETAAKWFGLLDKGGS
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtggccgaactcgtcgactcggacctgccgcgctccagtgcggccgtcgccgaacccacc
agccacgacccggacgcccgcggccacttcggcccgtacggcggacgcctcgttcccgag
gcgctgatggcggtcatcgaggaggtcaccgcggcctacgagaaggcccgtggcgaccag
acgttcctcgacgaactcgatcggctgcagcgccactacagcggccgtccttcgccgctg
tacgaggccacccggctcagcgagcacgccggcggggcgcgcatcttcctcaaacgagaa
gacctcaaccacacgggttcccacaagatcaacaatgtgctcgggcaggcgctgctcgca
cgtcagatgggcaagacccgggtcatcgccgagaccggcgccggccagcacggtgtcgcg
acggccaccgcctgcgcactgctcggcctggactgcgtgatctacatgggcgcggtcgac
acggcccgtcaggcgctgaatgtggcgcgcatgcgcctgctcggcgccgaggtggtctcc
gtggaggccggttcgaagacgctcaaggacgcgatcaacgaggccttccgcgactgggtc
accaacgccgacgagacgtactactgcttcggcaccgcggcgggcccgcacccgttcccg
ttgatggtgcgcgatttccagcgcatcatcggcctcgaagcgcgggcccagatccaggcc
caggccggccggctcccggatgcggtgacggcgtgcgtcggcggcggctccaatgcgatc
ggcgtcttccacgccttcatcgacgatcccggtgtgcggttgatcggttacgaggcggcc
ggagacggggtcgaaacgggccggcacgccgccacgttcaccggcggctcacccggtgcg
ttccagggctccttctcctacctgctgcaggacgaggacggccagacgatcgaatcgcat
tcgatctcggccggtctggactatccaggcgtggggcccgagcacgcgctgctcaaggac
atcggtcgcgccgagtaccggcccatcaccgataccgaggccatggacgcgttctcgctg
ctgtgccgcaccgaggggatcatcccggccatcgagtccgcgcacgcggtcgccggggcg
ctcaagctcggcccggaactcgggccgggttcggtgatcctggtcaacctgtccgggcgc
ggtgacaaggacgtcgagaccgcggcgaaatggttcggtctgctggacaaaggcggttca
tga

DBGET integrated database retrieval system