KEGG   Mycobacterium sp. JLS: Mjls_3067Help
Entry
Mjls_3067         CDS       T00482                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mjl01100  Metabolic pathways
mjl01110  Biosynthesis of secondary metabolites
mjl01130  Biosynthesis of antibiotics
mjl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mjls_3067
Enzymes [BR:mjl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mjls_3067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh NanE His_biosynth OMPdecase
Motif
Other DBs
NCBI-ProteinID: ABN98846
JGI: mjls3067
UniProt: A3Q119
Position
complement(3208434..3209252)
Genome map
AA seq 272 aa AA seqDB search
MSSATVLDSIIEGVRADVAAREAVVSLTEIKERAQRAKPPLDVMAALREPGIGVIAEVKR
ASPSRGALAQIGDPADLARAYQDGGARVISVLTEQRRFNGSLDDLDAVRAAVSIPVLRKD
FIVRPYQIHEARAHGADMLLLIVAALEQPVLESLLERTESLGMTALVEVHTEAEADRALQ
AGARVIGVNARNLKTLEVDRDCFARIAPGLPSNVIRIAESGVRGPADLLAYAGAGADAVL
VGEGLVTSRDPRSAVADLVTAGTHPSCPKPSR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagttcggcgaccgtgctcgactccatcatcgagggagtccgcgccgacgttgccgct
cgagaggccgtggtcagcctcaccgagatcaaggaacgggcgcagcgcgcgaagcctcca
ctggacgtgatggccgccctgcgcgaacccggcatcggggtcatcgccgaggtcaagcgg
gccagtccgtcccggggagcgctcgcccagatcggggatcccgccgacctggcccgcgcc
tatcaggacggcggcgcccgcgtgatcagcgtgctgaccgaacagcgccggttcaacggt
tcgctcgacgacctcgacgcagtccgcgcggcggtgtcgatcccggtcctgcggaaggac
ttcatcgtccggccgtatcagatccacgaagcccgcgcccacggtgccgacatgttgctg
ctcatcgtcgccgcactcgaacagcccgtgctcgagtcgttgctggagcgcaccgagtcg
ctcgggatgacggcgctggtggaggtccacaccgaagccgaagccgaccgcgcactgcag
gccggtgcccgggtgatcggcgtcaacgcgcggaatctcaagaccctcgaggtggaccgc
gactgcttcgcgcgcatcgccccgggactgccgtcgaatgtcatccgcatcgcggagtcc
ggcgtgcgcggccctgccgacctgctggcgtacgccggtgccggtgccgacgccgtgctc
gtcggcgaaggcctggtgaccagccgcgacccccgcagtgcggtggccgacctggtgacc
gccggaacccatccgtcctgcccgaaaccgtcccgatag

DBGET integrated database retrieval system