KEGG   Mycobacterium sp. JLS: Mjls_3236Help
Entry
Mjls_3236         CDS       T00482                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
mjl  Mycobacterium sp. JLS
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mjls_3236
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mjls_3236
  Lipid metabolism
   00071 Fatty acid degradation
    Mjls_3236
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mjls_3236
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mjls_3236
   00626 Naphthalene degradation
    Mjls_3236
Enzymes [BR:mjl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mjls_3236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3390312..3391412
Genome map
AA seq 366 aa AA seqDB search
MIAEAMVLTGPRSLQRRQMTIPDVGDRGAILRVEACGLCGTDHEQFTGHLPAGFSFVPGH
EIVGIVEHVGAAAGQRWGVQAGQRVAVEVFRSCRDCPECRRGEYRRCAVNGIATMFGFVD
VEVGAGLWGGYATHVELPWDAMLLPIAEDMDPVLATLFNPLGAGIQWGATLPDTKAGDVV
AILGPGIRGICAAVAAKEAGAAFVAMTGVGPRDEQRLAIARSFGVDLPIDVSQDDAVTAL
QRETGGRLADVVVDVTAKAPSAFADAVGLARPGGTIVVAGTRGGGGAPRFEPDLLVYKEL
HVVGALGVEYPAHRAALEILALGRWPFDRITRESTGFAGLAQLLTSLADESARSSGALHN
VFLPTP
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgaggcgatggtgctgaccggaccgcggagtctgcagcggcgccagatgacc
atccccgacgtcggcgaccggggtgcgatcctgcgagttgaagcatgcggtctgtgcgga
acagatcacgaacaattcaccggacacctgcctgccggcttctcattcgttccagggcac
gaaatcgtcggcatcgtcgaacatgttggcgctgcggctggccaacgctggggtgtacaa
gccggccagcgcgtggccgttgaggtgttccggtcctgccgagactgccccgagtgccgc
cgcggcgaataccggcggtgcgcggtgaacggcatcgccaccatgttcgggtttgtcgac
gtggaggtcggcgcgggcttatggggcggatacgccacccatgtggagcttccgtgggac
gcgatgctgctcccgattgccgaagacatggaccccgttctcgccacgttgttcaaccct
ctcggggccggtatccagtggggggcgactcttcccgacaccaaggccggggacgtcgta
gcgatcctggggcccggcatccgcggaatctgtgcggcggtggcggccaaagaggcggga
gccgcgttcgtcgcgatgaccggcgtaggcccacgcgacgaacaacgactggccatagcc
agatcattcggtgtcgacctgcccatcgatgtatcgcaggacgatgcagtgaccgcgctc
cagcgtgagacaggcggacggcttgccgacgtggtcgtcgacgtcaccgctaaagcaccc
tccgcgttcgccgatgccgtcggccttgccaggcccggcggcacaattgtggtggccggc
acccgtggaggaggcggcgcgccccggtttgaaccagacttgttggtctataaagaatta
cacgtcgtaggcgcactcggcgtggagtatcccgcccaccgggcagccctcgagattctc
gccctgggccgctggccgttcgaccggatcaccagagaatcaaccggattcgctgggctc
gcgcagctgctcacttcgcttgcagatgaaagtgcccgatcaagtggggcgctgcacaac
gtctttttgcccacgccctaa

DBGET integrated database retrieval system