KEGG   Mycobacterium sp. JLS: Mjls_3294Help
Entry
Mjls_3294         CDS       T00482                                 

Definition
putative agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mjl  Mycobacterium sp. JLS
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mjls_3294
Enzymes [BR:mjl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Mjls_3294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3453049..3454086)
Genome map
AA seq 345 aa AA seqDB search
MQTLKLHGRIVSNVDATRIGAGRRLRSMTGHILGAVPATEVPRYAGKSTFARIADIGEVS
DYDIAILGVPFDGGTSYRPGARFGPMGVRQAARTLRPGYHVELGVAPLERVQVVDAGDVT
VTPYDIAEACRQIQNHAADILGGGSRRIVAIGGDHTIALPNLRALHAVHGPVALVHFDAH
LDTWDTYFNAPVTHGTIFRRAFEEGLLVEDHSIHVGIRGPIYDQIDLHEDAEMGFKIIRA
GDLDVIGIDAAVDTVRRRVGDAPVYLSVDIDVLDPAFAPGTGTPESGGLTARELLRMLRR
LHGLNIVGGDVVEVAPAYDHAEITCVAAATVVFDLVSLMVAGGAG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgcagacgctcaaacttcatggccggattgtgtcaaacgtcgacgcgacacgcatcggt
gccggccgcaggctgaggtccatgaccggacacatcctgggcgccgtgcccgccaccgag
gtgccccgctacgccggcaagagcaccttcgcccgcatcgccgacatcggggaggtcagt
gactacgacatcgcgatcctcggtgtcccgttcgacggcggcacgtcataccggcccggt
gcgcgcttcggacccatgggggtgcgccaggccgcgcgcacgctgcgccccgggtaccac
gtcgaactcggggtcgcgccgctggaacgggtgcaggtcgtcgacgccggtgacgtcacc
gtcaccccctacgacatcgccgaggcctgccgccagatccagaaccacgccgccgacatc
ctcggcggcgggtcccgccggatcgtggccatcggcggcgaccacaccatcgcgctgccc
aacctgcgcgcgctgcacgcggtgcacggcccggtggccctggtgcacttcgatgcccac
ctcgacacctgggacacctacttcaacgccccggtcacgcacggcacgatcttccgtcgg
gcgttcgaggaaggcctgctggtcgaggaccactccatccacgtcggtatccgaggaccc
atctacgaccagatcgacctgcatgaggacgcggagatgggattcaagatcatccgggcg
ggcgacctggacgtgatcgggatcgacgccgcggtcgacaccgtgcgccgccgggtcggg
gacgcgccggtgtatctgtccgtcgacatcgacgtgctcgacccggcgttcgcccccggc
accggcaccccggaatccgggggcctcaccgccagggaactgctgcgcatgctgcggcgg
ttgcacgggctcaacatcgtcggtggtgatgtggtggaggtggcgcccgcctacgaccac
gccgagatcacctgtgtcgcagccgcgaccgtcgtattcgacctggtgtcgctgatggtc
gccggaggtgcgggctaa

DBGET integrated database retrieval system