KEGG   Mycobacterium sp. JLS: Mjls_3544Help
Entry
Mjls_3544         CDS       T00482                                 

Definition
(RefSeq) ribokinase-like domain-containing protein
  KO
K00852  
ribokinase [EC:2.7.1.15]
Organism
mjl  Mycobacterium sp. JLS
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mjls_3544
Enzymes [BR:mjl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Mjls_3544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
3733135..3733992
Genome map
AA seq 285 aa AA seqDB search
MAAARVCVVGSVNADLRFAVPSLPRPGQTVLASSMTTSPGGKGGNQAIAAARAGGDVSLV
AALGDDPAAGQLRAHLRANGVGLDGVVTVPGPSGSAVVIVDAAAENAIVVAPGANAHLSV
ASSAVREAIAGADVVLLQLEIPLHTANDAARVARDAGAVVMVNASPAGAPPHELLRLSEV
ADVVVVNQAEAGEWHWPVPHLVITRGARGASYLGDGERFDVPAPAVEAVDTTGAGDVFAG
VLAVHWRSGHENALRRACVAGALATLVPGAGDCAPTAEAIDDALR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgcgtgtctgcgtggtgggcagtgtgaacgccgatctgcgcttcgcggtg
ccgtcgctaccgcgccccggccagaccgtcctcgcgtcctcgatgacgacctcgcccggc
ggcaagggtggcaatcaggcgatcgccgcggcgcgggccggcggcgacgtctcgctggtg
gcagcactcggcgacgacccggcggccgggcagttgcgcgctcacctgcgcgcgaacggg
gtcggcctcgacggtgtggtgacggtgcccggccccagcggctcggccgtcgtgatcgtc
gacgccgccgcggagaacgccatcgtcgtcgcgcccggcgccaatgcgcacctgagcgtg
gcgtcgtcggcggtgcgtgaggcgatcgccggggcggacgtcgtgctcctgcaactcgag
atcccactgcatacggcgaacgacgcggcccgggtggcgcgcgatgcgggcgcggtggtg
atggtgaacgcctcccccgcgggcgcgccgccccacgagctgctgaggctgtccgaagtg
gccgacgtggtggtggtcaatcaggccgaggccggtgaatggcattggccggttccgcat
ctggtcatcacccgcggcgcccgcggggcgagctacctcggtgacggtgagcggttcgac
gtcccggcacccgcggtcgaggccgtcgacaccaccggcgccggtgacgtgttcgccgga
gtgctggccgtgcattggcggtccggacacgagaacgcgttgcgccgcgcgtgcgtcgcg
ggcgcgctggccaccctggtacccggcgcgggtgactgcgctcccaccgccgaagcgatc
gacgacgcattgagatga

DBGET integrated database retrieval system