KEGG   Mycobacterium sp. JLS: Mjls_3552Help
Entry
Mjls_3552         CDS       T00482                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mjl  Mycobacterium sp. JLS
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mjl01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mjl00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3741854..3742987)
Genome map
AA seq 377 aa AA seqDB search
MTEAATRPSVHREAVRTARSVVVKIGTTALTTPTGVFDANRLATLVEAIEKRMKAGSDVV
IVSSGAIAAGIEPLRLSKRPTDLATKQAAASVGQVALINSWNTAFARYERTVGQVLLTAH
DISMRVQHTNAARTLDRLRALHAVAIVNENDTVATNEIRFGDNDRLSALVAHLVGADALV
LLSDIDGLYDGDPRKAGPDNPARFIAEVNGADDLDGVVAGRGSHLGTGGMASKLSSALLA
ADAGVPVLLAAAADAATALSDASVGTVFAPRAERMSARRFWVRYAAESTGALTLDEGAVN
AVVRQRRSLLPAGITGVSGRFYGGDVVELRAPDATMVARGVVAYDATELATMLGRSTSDL
PADMRRPAVHADDLVAV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggccgccacccgtccgtccgtgcaccgcgaggccgtccgcaccgcgcgcagt
gtcgtcgtcaagatcggcaccaccgcgctgaccacgccgaccggcgtattcgacgccaac
cggctggccacgctggtcgaggcgatcgagaagcggatgaaggcgggctccgacgtcgtc
atcgtgtcgtccggcgccatcgcggccggtatcgaaccgttgcggctgtccaagcggccg
accgatctggccaccaaacaggccgccgccagcgtcgggcaggtcgcgctgatcaactcg
tggaacaccgccttcgcccggtatgagcgcaccgtcggacaggtgctgctcaccgcccac
gacatctcgatgcgcgtgcagcacaccaacgccgcccgcaccctcgaccggttgcgcgca
ctgcacgccgtggcgatcgtcaacgagaacgacacggtcgcgaccaacgagatccggttc
ggcgacaacgaccggctctcggcactggtggcgcatctggtgggggcggatgcgctcgtg
ctgctctccgatatcgacggcctctacgacggcgatccgcggaaagcgggcccggacaac
ccggcccgcttcatcgccgaggtcaacggagccgacgacctcgacggggtggtggccggg
cgcggcagccacctcggcaccggcggtatggcgtcgaagttgtcgtcggcgctgctggcc
gcagatgccggtgttccggtgctgctggccgccgccgccgacgctgccaccgcactgtcg
gatgcgtcggtcggcacggtgttcgcccctcgcgcggagcggatgtcggcgcggcgcttc
tgggtgcggtacgccgccgagtccacaggtgcgttgaccctcgacgagggtgcggtcaat
gccgttgtgcggcaacggcgttcgctgctgcccgcgggtatcaccggggtgtcgggacgg
ttctacggcggcgacgtcgtggagttgcgcgcacccgatgcgaccatggtcgcccgtggc
gtggtggcctacgacgcgaccgaactggccaccatgctgggccgttcgacgtcggaccta
cccgccgacatgcgcaggccggccgtccacgccgacgacctcgtcgccgtctga

DBGET integrated database retrieval system