KEGG   Mycobacterium sp. JLS: Mjls_3629Help
Entry
Mjls_3629         CDS       T00482                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00010  Glycolysis / Gluconeogenesis
mjl00020  Citrate cycle (TCA cycle)
mjl00620  Pyruvate metabolism
mjl01100  Metabolic pathways
mjl01110  Biosynthesis of secondary metabolites
mjl01120  Microbial metabolism in diverse environments
mjl01130  Biosynthesis of antibiotics
mjl01200  Carbon metabolism
Module
mjl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mjls_3629
   00020 Citrate cycle (TCA cycle)
    Mjls_3629
   00620 Pyruvate metabolism
    Mjls_3629
Enzymes [BR:mjl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mjls_3629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ABN99406
JGI: mjls3629
Position
complement(3836430..3837584)
Genome map
AA seq 384 aa AA seqDB search
MTVQEFLVPDLGEGLQDATITSWAVDVGDEVELNQTLCTVETNKAEVEIPSPYAGRVVER
GGDEGQTLDVGSLLVRIATSADEPVPQRKSVLVGYGADEAMDTSRRRSARPRAKPPVRKL
AAELDVDLNAVSASGPDGVVTREDVQRAAEGWAPAAEQVAVRGVQAEMARRMSLSRREIP
DAHASVTVDGSALLRLRDRLLGTDPPVTPFVLTLRLLTLALRHQPALNATWIETAEGPQI
HRHTAVHLGFGVAAPRGLLVPVIADAQDMTTRGLAAAVGRLVAEARAGRVRPAELSGSTF
TVSNFGALGLDEGVPVINHPEAAILGMGSLKPRAVVVDGEVVARPTMTLTCAFDHRIADG
ATVAAFLGELRELVEAPELALLDL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgcaggagttcctggtgccggatctgggtgagggtctgcaggacgcgacgatc
acctcgtgggcggtcgatgtcggtgacgaggtcgagctgaaccagacgctgtgcaccgtc
gagacgaacaaggcggaggtcgagatccccagcccgtacgccggccgggtggtcgaacgc
gggggagacgagggtcagacgctcgacgtgggatccctgctggtgcggatcgcgacatca
gcggatgaaccggtgccgcaacgcaaatcggtactggtcggatacggcgccgatgaggcg
atggataccagcaggcgccggtcggcgcggccgcgcgccaaaccgccggtgcgcaagctg
gcggccgaactggacgtggatctcaacgcggtcagcgcatcgggacccgacggcgtggtc
acccgcgaggacgtgcagcgtgcggcggaaggctgggcgccggccgcggagcaggtcgcg
gtgcggggtgtccaggcggagatggcgcgacggatgtcgttgtcgcggagggagatcccg
gatgcccacgccagcgtcacggtcgacggcagcgcactgctgcggctgcgggacagactg
ctcggcaccgacccgccggtgacgcccttcgtgctgacgctgcgactgctgacgctggcg
ctgcggcaccagccggcgctgaacgccacctggatcgagacggcggaggggccgcagatc
caccggcacactgcagtccacctcggattcggtgtcgccgcgccgcgcgggctgctggtg
ccggtgatcgcggacgcgcaggacatgaccacgcgtggactcgcggccgcggtggggcgg
ctggtggcggaggctcgcgccggacgggtgcggccggcggagctgtcggggtcgacgttc
accgtctcgaatttcggtgcgctcgggctcgacgagggcgtgccggtgatcaaccatccg
gaggctgcgatcctgggcatgggttcgttgaagccgcgcgcggtggtcgtcgacggtgag
gtggtcgcccggccgacgatgacgttgacgtgcgccttcgaccatcgcatcgccgacggg
gccaccgtggcggccttcctgggcgagttgcgcgagctcgtcgaagcgccggagctcgcg
ctgctcgacctgtga

DBGET integrated database retrieval system