KEGG   Mycobacterium sp. JLS: Mjls_3881Help
Entry
Mjls_3881         CDS       T00482                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mjl  Mycobacterium sp. JLS
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mjls_3881
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mjls_3881
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mjls_3881
Enzymes [BR:mjl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mjls_3881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4108432..4109514)
Genome map
AA seq 360 aa AA seqDB search
MSTPVNAVHRRWPGLIEAYRDRLPVGDDWTPVTLLEGGTPLIHAKRLSEFTGCTVHLKVE
GLNPTGSFKDRGMTVAVTESAASGKQAVLCASTGNTSASAAAYAARAGITCAVLIPQGKI
AMGKLAQAVMHGAKIIQIDGNFDDCLELARKLTADFPTVALVNSVNPYRIEGQKTAAFEI
VDVLGAAPDIHALPVGNAGNITAYWKGYSEYHRDGLSDRLPRMLGTQAAGAAPLVTGEPV
KNPETIATAIRIGAPASWASAVEAQQQSDGRFLAATDEEILAAYHLVARTEGVFVEPASA
ASIAGLLKSVEDGWVAKGSTVVCTVTGNGLKDPDTALKGMPTVTPLAVDPVAVAAELGLV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcccgtgaacgcggtgcaccggcgctggccgggcctgatcgaggcctaccgc
gaccggcttcccgtcggcgacgactggacgccggtcaccctgctcgagggtggcacgccg
ctgatacacgccaagcggttgagcgaattcaccggctgcacagtgcatctgaaggtcgag
gggctcaacccgaccggttcgttcaaggaccgcgggatgacggtcgcggtcaccgagtcg
gcggccagcggtaagcaggcggtgctgtgcgcatcgacgggcaacacctccgcctcggca
gcggcgtatgcggcccgcgccggcatcacgtgtgcggtgctgatcccgcagggcaagatc
gcgatgggcaagctggcccaggcggtcatgcacggcgccaagatcattcagatcgacggg
aacttcgacgactgcctcgaactcgcccgcaagctgaccgccgacttcccgaccgtcgca
ctggtcaactcggtcaacccctaccgcatcgagggtcagaagaccgccgcgttcgagatc
gtcgacgtcctgggcgccgcgcccgacatccacgctctgccggtcggcaacgcgggcaac
atcaccgcctactggaagggctacagcgagtaccaccgcgacggcctgtccgaccggttg
ccccggatgctgggcacccaggcggcgggggccgcgccgctggtgaccggtgagcccgtg
aagaacccggagacgatcgccaccgcgatccgcatcggcgcccccgcgtcgtgggcgtcg
gcggtcgaagcccagcagcagtcggacggccgcttcctggcggcgaccgacgaggagatc
ctggcggcgtaccacctggtcgcgcgcaccgaaggagtcttcgtcgaaccggcctcggcg
gccagcatcgccgggctgctcaagtccgtcgaggacggctgggtggccaagggatcgacc
gtggtgtgcaccgtcaccggcaacggactcaaggatcccgacaccgcgctcaagggaatg
cccaccgtcacaccgctcgccgtggatccggtggcggtggcggccgaactcggtctggtc
tga

DBGET integrated database retrieval system