KEGG   Mycobacterium sp. JLS: Mjls_3881Help
Entry
Mjls_3881         CDS       T00482                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00260  Glycine, serine and threonine metabolism
mjl00750  Vitamin B6 metabolism
mjl01100  Metabolic pathways
mjl01110  Biosynthesis of secondary metabolites
mjl01120  Microbial metabolism in diverse environments
mjl01230  Biosynthesis of amino acids
Module
mjl_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mjls_3881
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mjls_3881
Enzymes [BR:mjl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mjls_3881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABN99657
JGI: mjls3881
Position
complement(4108432..4109514)
Genome map
AA seq 360 aa AA seqDB search
MSTPVNAVHRRWPGLIEAYRDRLPVGDDWTPVTLLEGGTPLIHAKRLSEFTGCTVHLKVE
GLNPTGSFKDRGMTVAVTESAASGKQAVLCASTGNTSASAAAYAARAGITCAVLIPQGKI
AMGKLAQAVMHGAKIIQIDGNFDDCLELARKLTADFPTVALVNSVNPYRIEGQKTAAFEI
VDVLGAAPDIHALPVGNAGNITAYWKGYSEYHRDGLSDRLPRMLGTQAAGAAPLVTGEPV
KNPETIATAIRIGAPASWASAVEAQQQSDGRFLAATDEEILAAYHLVARTEGVFVEPASA
ASIAGLLKSVEDGWVAKGSTVVCTVTGNGLKDPDTALKGMPTVTPLAVDPVAVAAELGLV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcccgtgaacgcggtgcaccggcgctggccgggcctgatcgaggcctaccgc
gaccggcttcccgtcggcgacgactggacgccggtcaccctgctcgagggtggcacgccg
ctgatacacgccaagcggttgagcgaattcaccggctgcacagtgcatctgaaggtcgag
gggctcaacccgaccggttcgttcaaggaccgcgggatgacggtcgcggtcaccgagtcg
gcggccagcggtaagcaggcggtgctgtgcgcatcgacgggcaacacctccgcctcggca
gcggcgtatgcggcccgcgccggcatcacgtgtgcggtgctgatcccgcagggcaagatc
gcgatgggcaagctggcccaggcggtcatgcacggcgccaagatcattcagatcgacggg
aacttcgacgactgcctcgaactcgcccgcaagctgaccgccgacttcccgaccgtcgca
ctggtcaactcggtcaacccctaccgcatcgagggtcagaagaccgccgcgttcgagatc
gtcgacgtcctgggcgccgcgcccgacatccacgctctgccggtcggcaacgcgggcaac
atcaccgcctactggaagggctacagcgagtaccaccgcgacggcctgtccgaccggttg
ccccggatgctgggcacccaggcggcgggggccgcgccgctggtgaccggtgagcccgtg
aagaacccggagacgatcgccaccgcgatccgcatcggcgcccccgcgtcgtgggcgtcg
gcggtcgaagcccagcagcagtcggacggccgcttcctggcggcgaccgacgaggagatc
ctggcggcgtaccacctggtcgcgcgcaccgaaggagtcttcgtcgaaccggcctcggcg
gccagcatcgccgggctgctcaagtccgtcgaggacggctgggtggccaagggatcgacc
gtggtgtgcaccgtcaccggcaacggactcaaggatcccgacaccgcgctcaagggaatg
cccaccgtcacaccgctcgccgtggatccggtggcggtggcggccgaactcggtctggtc
tga

DBGET integrated database retrieval system