KEGG   Mycobacterium sp. JLS: Mjls_4668Help
Entry
Mjls_4668         CDS       T00482                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00040  Pentose and glucuronate interconversions
mjl00052  Galactose metabolism
mjl00500  Starch and sucrose metabolism
mjl00520  Amino sugar and nucleotide sugar metabolism
mjl01100  Metabolic pathways
mjl01130  Biosynthesis of antibiotics
Module
mjl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mjls_4668
   00052 Galactose metabolism
    Mjls_4668
   00500 Starch and sucrose metabolism
    Mjls_4668
   00520 Amino sugar and nucleotide sugar metabolism
    Mjls_4668
Enzymes [BR:mjl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mjls_4668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Imm75 IspD
Motif
Other DBs
NCBI-ProteinID: ABO00434
JGI: mjls4668
Position
complement(4903579..4904490)
Genome map
AA seq 303 aa AA seqDB search
MSRPEVPIPYTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAEAGAERLVI
ITSEGKDGVVAHFVEDLVLEGTLEARGKKTMLEKVRRAPALIKVESVVQAEPLGLGHAVS
CVEPTLSDDEDAIAVLLPDDLVLPTGVLETMSKVRAKRGGSVLCAIEVPPEKISAYGVFD
VEEVPDATNPNVLRVKGMVEKPKAEDAPSPYAAAGRYVLDRAIFDALRRVKRGAGNEIQL
TDAIALLIEEGHPVHVVVHRGTRHDLGNPGGYLKAAVDFALERDDYGPELRQWLVERLGL
TEN
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagtcggccagaagtacccattccgtataccgctgtcgtgcccgccgcgggcctgggc
acgcgtttcctccccgccaccaagacggtgcccaaggaattgctgccggtcgtggacacc
cccgggatcgaattggtggccgccgaggccgccgaggcgggtgccgaacggctcgtcatc
atcacgtccgagggcaaggacggcgtggtcgcgcacttcgtcgaggacctggtgctcgag
gggacgctcgaggcccgcggtaagaagaccatgctcgagaaggtgcggcgcgcgcccgcg
ctgatcaaggtggaatcggtggttcaggccgaaccgctcggcctcggtcacgccgtcagc
tgcgtggagcccacgctgtccgacgacgaggatgcgatcgcggtgctgctgcccgacgac
ctcgtgctgccgaccggtgttctcgagacgatgtcgaaggtgcgcgcgaaacgcggcggt
tcggtgttgtgcgcgatcgaggtgccgcccgagaagatcagcgcctacggcgtattcgac
gtcgaagaggtgcccgacgccaccaaccccaacgtcctgcgcgtcaaggggatggtcgag
aaacccaaggccgaggatgccccgtcgccgtacgccgcggccggccgctacgttttggac
cgagcgatcttcgacgcgctgcgacgggtcaagcggggtgcgggcaacgagatccagttg
accgacgcgatcgcgctgctgatcgaggagggccatccggtgcacgtggtggtccaccgc
ggaacccgacacgacctgggaaatcccggcggctacctcaaggctgcggttgactttgcg
ttggaacgcgacgactacggccccgagctgcggcagtggttggtcgagcgattgggcctg
accgagaactag

DBGET integrated database retrieval system