KEGG   Mycobacterium sp. JLS: Mjls_4668Help
Entry
Mjls_4668         CDS       T00482                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mjl  Mycobacterium sp. JLS
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mjls_4668
   00052 Galactose metabolism
    Mjls_4668
   00500 Starch and sucrose metabolism
    Mjls_4668
   00520 Amino sugar and nucleotide sugar metabolism
    Mjls_4668
Enzymes [BR:mjl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mjls_4668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4903579..4904490)
Genome map
AA seq 303 aa AA seqDB search
MSRPEVPIPYTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAEAGAERLVI
ITSEGKDGVVAHFVEDLVLEGTLEARGKKTMLEKVRRAPALIKVESVVQAEPLGLGHAVS
CVEPTLSDDEDAIAVLLPDDLVLPTGVLETMSKVRAKRGGSVLCAIEVPPEKISAYGVFD
VEEVPDATNPNVLRVKGMVEKPKAEDAPSPYAAAGRYVLDRAIFDALRRVKRGAGNEIQL
TDAIALLIEEGHPVHVVVHRGTRHDLGNPGGYLKAAVDFALERDDYGPELRQWLVERLGL
TEN
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagtcggccagaagtacccattccgtataccgctgtcgtgcccgccgcgggcctgggc
acgcgtttcctccccgccaccaagacggtgcccaaggaattgctgccggtcgtggacacc
cccgggatcgaattggtggccgccgaggccgccgaggcgggtgccgaacggctcgtcatc
atcacgtccgagggcaaggacggcgtggtcgcgcacttcgtcgaggacctggtgctcgag
gggacgctcgaggcccgcggtaagaagaccatgctcgagaaggtgcggcgcgcgcccgcg
ctgatcaaggtggaatcggtggttcaggccgaaccgctcggcctcggtcacgccgtcagc
tgcgtggagcccacgctgtccgacgacgaggatgcgatcgcggtgctgctgcccgacgac
ctcgtgctgccgaccggtgttctcgagacgatgtcgaaggtgcgcgcgaaacgcggcggt
tcggtgttgtgcgcgatcgaggtgccgcccgagaagatcagcgcctacggcgtattcgac
gtcgaagaggtgcccgacgccaccaaccccaacgtcctgcgcgtcaaggggatggtcgag
aaacccaaggccgaggatgccccgtcgccgtacgccgcggccggccgctacgttttggac
cgagcgatcttcgacgcgctgcgacgggtcaagcggggtgcgggcaacgagatccagttg
accgacgcgatcgcgctgctgatcgaggagggccatccggtgcacgtggtggtccaccgc
ggaacccgacacgacctgggaaatcccggcggctacctcaaggctgcggttgactttgcg
ttggaacgcgacgactacggccccgagctgcggcagtggttggtcgagcgattgggcctg
accgagaactag

DBGET integrated database retrieval system