KEGG   Mycobacterium sp. JLS: Mjls_4694Help
Entry
Mjls_4694         CDS       T00482                                 

Definition
putative magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mjl  Mycobacterium sp. JLS
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mjls_4694
Enzymes [BR:mjl01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mjls_4694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4933062..4934447)
Genome map
AA seq 461 aa AA seqDB search
MVTQPHDLPRTVGELRASGHRERGVKQEIQENLLAGLAEGRDMWPGILGFEDTVIPQLER
ALIAGHDIVLLGERGQGKTRLLRALTGLLDEWTPVIEGSELGEHPYTPITPESIRRVADS
GDDLKVAWRHRSERYTEKLATPDTSVADLVGDIDPIKVAEGRSLGDPETIAYGLIPRAHR
GIVAVNELPDLAERIQVSMLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGRIIT
PLKDRFGAEIRTHYPLQLDAEVGVITQEAQLAAAVPDHLLQILARFARNLRESSSVDQRS
GVSARFAIAAAETVAAAARHRSTILGEQEPVARVVDLGTVVDVLRGKLEFESGEEGREQV
VLEHLLRRATADTAQRLLGGLDVGPLVAAVEEGSPVTTGERVSAKDVLAALPDLPVIDAI
ATRLGAQTDGERAAAVELALEALYLAKRIDKVSGEGETVYG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtggtgacccaaccccatgatctgccccggaccgtcggcgaactacgcgcctccggccat
cgcgagcggggcgtcaaacaggaaatccaggagaacctgctggccggattggccgagggc
cgcgacatgtggcccgggatcctgggtttcgaggacacggtgatcccgcaactcgagcgg
gctttgatcgccggacacgacatcgtgctgctcggtgagcgcggccagggcaagacccgg
ctgctgcgcgcgctgaccggactgctcgacgagtggacgcccgtcatcgaggggtcggaa
ctgggcgagcacccgtacaccccgatcacccccgaatccatccggcgggttgccgattcg
ggcgacgacctgaaggtggcctggcgccaccgcagcgagcggtacaccgagaaactcgcc
accccggacaccagcgtggccgacctggtcggcgacatcgacccgatcaaggtggccgag
ggccgcagcctcggcgacccggagaccatcgcctacggcctgatcccgcgcgcacaccgc
ggcatcgtcgcggtcaacgagctgcccgacctcgccgagcgcatccaggtgtcgatgctc
aacgtgatggaggagcgcgacatccaggtccgcggctacacgctgcggctgccgctcgac
gtcctcgtcgtcgccagcgcgaacccggaggactacaccaaccgcggtcgcatcatcacc
ccgctcaaggaccggttcggcgccgagatccgcacgcactatccgctgcagctcgacgcg
gaggtcggcgtcatcacccaggaggcgcagctcgcggcggccgtccccgaccacctgctg
cagatcctcgcccgcttcgcccgcaacctgcgcgaatcgagttcggtggatcagcgttcg
ggcgtctccgcgcggttcgcgatcgccgcggccgagaccgtcgccgcggccgcccggcac
cgctcgacgatcctcggggagcaggagccggtcgcccgcgtggtcgacctcggcaccgtc
gtcgacgtgctgcgcggcaagctcgagttcgaatccggtgaagagggtcgtgagcaggtg
gtgctcgagcacctgctgcgccgcgccaccgccgacaccgcgcagcggttgctcggtggt
ctcgacgtcgggccgctcgtcgcggcggtcgaggagggttccccggtgacgacgggtgaa
cgtgtgtccgccaaggacgtgctggccgcgctgccggacctgccggtgatcgacgcgatc
gccacccggctgggtgcgcagaccgacggtgaacgcgccgccgccgtcgaactggcgctc
gaggcgctgtacctggccaagcggatcgacaaggtctccggagagggcgaaaccgtctat
ggctga

DBGET integrated database retrieval system