KEGG   Mycobacterium sp. JLS: Mjls_4940Help
Entry
Mjls_4940         CDS       T00482                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mjl  Mycobacterium sp. JLS
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Mjls_4940
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Mjls_4940
Enzymes [BR:mjl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Mjls_4940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5180839..5181336)
Genome map
AA seq 165 aa AA seqDB search
MTESYLLDIELNTLDGTSTSLRELADGAVLVVNVASKCGLTPQYSALEKLAQDYGDRGLT
VIGVPCNQFMGQEPGTAEEIQTFCSTTYGVTFPLLAKTDVNGADRHPLYAELTQTPDAGG
EAGDVQWNFEKFLLAPGGEVVNRFRPRTEPDAPEVISAIEAVLPK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtcgtacctgctcgacatcgagctcaacacactcgacggcacctcgacgtct
ctgagggagctggccgacggcgccgtgctcgtggtcaacgtcgcgtcgaagtgcgggctc
accccgcagtacagcgcgctggagaagctggcgcaggactacggcgaccgcggtctgacg
gtgatcggcgtgccgtgcaaccagttcatggggcaggaaccggggacggccgaagaaatc
cagacgttctgctcgaccacctacggcgtgaccttcccgctgctggccaagaccgacgtc
aacggagccgaccgccacccgctctacgccgagctgacgcagacgcccgacgccggcggt
gaggcgggcgacgtgcagtggaacttcgagaagttcctgctcgcgccgggcggtgaggtc
gtcaaccggttccggccgcgcaccgaacccgacgcccccgaggtgatctccgccatcgag
gccgtcctcccgaaatag

DBGET integrated database retrieval system