KEGG   Mycobacterium sp. JLS: Mjls_5043Help
Entry
Mjls_5043         CDS       T00482                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mjl  Mycobacterium sp. JLS
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mjl00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mjl00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:mjl00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:mjl00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:mjl00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5285314..5286246)
Genome map
AA seq 310 aa AA seqDB search
MPEKLQVAIVGSGNISTDLLYKLQRSEYLEPRWMIGIDPESEGLARARKLGLETSHEGVD
WLLAQDDKPDLVFEATSAYVHRAAAPRYEEAGIRAIDLTPAAVGPAVIPPANLREHLDAP
NVNMITCGGQATIPIVYAVTRAVTEQGGTVPYAEIVASVSSSSAGPGTRANIDEFTKTTS
KGVQTIGGAARGKAIIILNPADPPMIMRDTIFCAIPEDADRDAIAQSIRDVVAEVQTYVP
GYRLLNDPQFDDPSINSGGQAVVTTFVEVEGAGDYLPPYAGNLDIMTAAAAKVGEEIAKE
SLSLAGGAQA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgccggagaagcttcaggtcgcgatcgtcgggtccggcaacatcagcaccgatctgctg
tacaagctgcagcgctcggagtacctcgaaccgcgttggatgatcggaatcgatcccgag
tccgaagggctcgcgcgcgcacgcaaactcggcctcgagacctcgcacgagggcgtggat
tggctgctcgcacaggacgacaaaccggatctggtgttcgaggccaccagcgcctacgtg
caccgggcggcggcaccgcgctacgaggaagcgggtatccgcgccatcgacctcaccccg
gccgcggtgggtccggcggtgatcccgccggccaacctgcgcgaacacctcgacgcaccg
aacgtcaacatgatcacctgtggtgggcaggccaccatccccatcgtctacgcggtcacc
cgcgcggtcaccgaacagggcggcacggtgccctacgccgagatcgtcgcctcggtgtcg
tcgagttcggcgggtccgggtacccgcgccaacatcgacgagttcaccaagaccaccagt
aagggtgtgcagaccatcggcggtgccgcgcgggggaaggcgatcatcatcctcaacccc
gccgatccgccgatgatcatgcgcgacaccatcttctgcgccatccccgaggacgccgac
cgggatgcgatcgcccagtcgatccgcgacgtcgtcgccgaggtgcagacctacgtaccc
ggctatcgcctgctcaacgacccgcagttcgacgacccctcgatcaactccggcgggcag
gccgtggtcaccacgttcgtggaggtggaaggcgcaggcgactacctgccgccgtacgcg
ggaaacctcgacatcatgaccgccgcggcggccaaggtgggcgaggagatcgcaaaggaa
tccctttctctggcaggaggtgcgcaggcatga

DBGET integrated database retrieval system