KEGG   Mycobacterium sp. JLS: Mjls_5152Help
Entry
Mjls_5152         CDS       T00482                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mjl  Mycobacterium sp. JLS
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mjls_5152
Enzymes [BR:mjl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Mjls_5152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5395065..5395595)
Genome map
AA seq 176 aa AA seqDB search
MTKVVLSIGSNVGDRLARLQSVVDGLGEAVRAVSPVYETAAWGGVEQGAFLNAVLIADDP
DLDCHGWLRRGQQLEQEADRVRGQRWGPRTLDVDIVTCHDGDTEVRSATAELTLPHPYAH
LRAFVLMPWLAAEPEATLTVADTTRPVSLWLEELDPAERAGVRRTDLALRTEIAAD
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagtcgtgttgtccatcgggtcgaatgtgggtgaccgtctggcacgcctgcag
tccgtcgtcgacggtctcggggaggccgtgcgcgcggtgtcgccggtgtacgagaccgcg
gcgtggggcggtgtcgaacagggcgccttcctcaacgcggtgctgatcgccgacgacccc
gacctcgactgccacggctggctgcgccgcggtcagcagttggagcaggaggccgaccgg
gtccgcggacagcggtgggggccccgcaccctcgacgtcgacatcgtcacctgccacgac
ggggacaccgaagtgcgttccgcgactgcggagctcacgctgccgcatccgtacgcacat
ctgcgggcgttcgtcctgatgccgtggctggcggccgaaccggaggcgacgctgacggtg
gcggacacgacgcggccggtctcgctgtggctggaggaactcgaccccgccgagcgcgcg
ggtgtgcggcgcaccgacctggccctgcgcacggagatcgcggccgactga

DBGET integrated database retrieval system