KEGG   Mycobacterium sp. JLS: Mjls_5271Help
Entry
Mjls_5271         CDS       T00482                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mjl  Mycobacterium sp. JLS
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mjls_5271 (recR)
DNA repair and recombination proteins [BR:mjl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Mjls_5271 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5521582..5522193)
Genome map
AA seq 203 aa AA seqDB search
MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPPDIDRLTAVLNRIRDGVKFCEVCG
NVSDADRCRICSDPRRDASLVCVVEEPKDVQAVERTREFRGRYHVLGGALDPLSGVGPDQ
LRIRELLNRIGERVDGVDVAEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPM
GGDLEFADELTLGRALAGRRAMA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgaggggcccgtccaggatctgatcgacgaactcggcaaactgccggggatcggc
ccgaagagcgctcagcgcatcgcttttcacctgttgagcgtcgagccgcccgacatcgac
cggctcacggcggtgctcaaccggatccgcgacggggtgaagttctgcgaggtgtgcggc
aacgtctccgacgccgaccgctgccgcatctgctccgatccgcgccgcgacgcgtcgctg
gtgtgcgtggtcgaggaacccaaggacgtgcaggccgtcgagcgcacgcgtgagttccgc
ggccgctaccacgtgctgggcggggcgctcgacccgttgagtggggtggggccggatcaa
ctgcgcatccgcgagctgttgaaccggatcggcgagcgggtcgacggcgtcgacgtggcc
gaggtgatcatcgccaccgacccgaacaccgagggggaggcgacggccacgtatctggtg
cggatgctgcgcgacatccccgggttgaccgtcacgcggatcgcctcggggctgccgatg
ggcggcgatctcgaattcgccgacgagctcacgctgggccgcgcgctggccggccgccgg
gcgatggcctag

DBGET integrated database retrieval system