KEGG   Methanopyrus kandleri: MK0080Help
Entry
MK0080            CDS       T00078                                 

Gene name
PorG_1
Definition
pyruvate ferredoxin oxidoreductase subunit gamma (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mka  Methanopyrus kandleri
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mka00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MK0080 (PorG_1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MK0080 (PorG_1)
   00020 Citrate cycle (TCA cycle)
    MK0080 (PorG_1)
   00620 Pyruvate metabolism
    MK0080 (PorG_1)
   00640 Propanoate metabolism
    MK0080 (PorG_1)
   00650 Butanoate metabolism
    MK0080 (PorG_1)
  Energy metabolism
   00680 Methane metabolism
    MK0080 (PorG_1)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MK0080 (PorG_1)
Enzymes [BR:mka01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MK0080 (PorG_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
74941..75492
Genome map
AA seq 183 aa AA seqDB search
MIEIRIHGRGGQGAVTAAEILAIAAKEDGKYSQAFPFFGVERRGAPVTAFARIDDEFIKI
RSQIYEPDHVIVLDSSLLAVVDVTEGLPEDGLIVINAREEELDKIMEKFEDSDVYTVDAT
QIALDELGVPIVNTAMVGAYLKASDILTLDAVKKAIHARFSGEIAEKNVRAVERAYREVK
AVG
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgagatcagaatacacgggagaggcggccaaggagccgtcaccgcggccgagatc
ctggcgatcgcggcgaaggaggatgggaagtactcccaagcgttcccgtttttcggtgtg
gaacgccgtggagcgccagtgacggccttcgcccggatcgatgacgagttcatcaagatt
cgatcgcagatatacgagccggaccacgtgatagtactcgactccagcctgctggccgta
gtagacgttaccgaaggtctaccggaggacggtctcatcgttatcaacgctagggaggag
gagctagacaagatcatggagaagttcgaggattccgacgtctacactgtggacgcgacc
cagatcgcgctggacgagttaggtgtccctatcgtgaacaccgcgatggtcggtgcctat
ctgaaggcttccgatatcctcactctcgatgccgtgaagaaggccattcatgcacgcttc
tcgggagagatcgccgagaaaaacgtcagagccgttgaacgagcctaccgggaggtgaag
gcagttgggtaa

DBGET integrated database retrieval system