KEGG   Methanopyrus kandleri: MK0080Help
Entry
MK0080            CDS       T00078                                 

Gene name
PorG_1
Definition
pyruvate ferredoxin oxidoreductase subunit gamma (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mka  Methanopyrus kandleri
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mka00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MK0080 (PorG_1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MK0080 (PorG_1)
   00020 Citrate cycle (TCA cycle)
    MK0080 (PorG_1)
   00620 Pyruvate metabolism
    MK0080 (PorG_1)
   00640 Propanoate metabolism
    MK0080 (PorG_1)
   00650 Butanoate metabolism
    MK0080 (PorG_1)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MK0080 (PorG_1)
   00680 Methane metabolism
    MK0080 (PorG_1)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MK0080 (PorG_1)
Enzymes [BR:mka01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MK0080 (PorG_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
74941..75492
Genome map
AA seq 183 aa AA seqDB search
MIEIRIHGRGGQGAVTAAEILAIAAKEDGKYSQAFPFFGVERRGAPVTAFARIDDEFIKI
RSQIYEPDHVIVLDSSLLAVVDVTEGLPEDGLIVINAREEELDKIMEKFEDSDVYTVDAT
QIALDELGVPIVNTAMVGAYLKASDILTLDAVKKAIHARFSGEIAEKNVRAVERAYREVK
AVG
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgagatcagaatacacgggagaggcggccaaggagccgtcaccgcggccgagatc
ctggcgatcgcggcgaaggaggatgggaagtactcccaagcgttcccgtttttcggtgtg
gaacgccgtggagcgccagtgacggccttcgcccggatcgatgacgagttcatcaagatt
cgatcgcagatatacgagccggaccacgtgatagtactcgactccagcctgctggccgta
gtagacgttaccgaaggtctaccggaggacggtctcatcgttatcaacgctagggaggag
gagctagacaagatcatggagaagttcgaggattccgacgtctacactgtggacgcgacc
cagatcgcgctggacgagttaggtgtccctatcgtgaacaccgcgatggtcggtgcctat
ctgaaggcttccgatatcctcactctcgatgccgtgaagaaggccattcatgcacgcttc
tcgggagagatcgccgagaaaaacgtcagagccgttgaacgagcctaccgggaggtgaag
gcagttgggtaa

DBGET integrated database retrieval system