KEGG   Methanopyrus kandleri: MK0080Help
Entry
MK0080            CDS       T00078                                 

Gene name
PorG_1
Definition
pyruvate ferredoxin oxidoreductase subunit gamma (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mka  Methanopyrus kandleri
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:mka01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mka00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mka00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mka00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mka00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mka00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:mka00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:mka00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
74941..75492
Genome map
AA seq 183 aa AA seqDB search
MIEIRIHGRGGQGAVTAAEILAIAAKEDGKYSQAFPFFGVERRGAPVTAFARIDDEFIKI
RSQIYEPDHVIVLDSSLLAVVDVTEGLPEDGLIVINAREEELDKIMEKFEDSDVYTVDAT
QIALDELGVPIVNTAMVGAYLKASDILTLDAVKKAIHARFSGEIAEKNVRAVERAYREVK
AVG
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgagatcagaatacacgggagaggcggccaaggagccgtcaccgcggccgagatc
ctggcgatcgcggcgaaggaggatgggaagtactcccaagcgttcccgtttttcggtgtg
gaacgccgtggagcgccagtgacggccttcgcccggatcgatgacgagttcatcaagatt
cgatcgcagatatacgagccggaccacgtgatagtactcgactccagcctgctggccgta
gtagacgttaccgaaggtctaccggaggacggtctcatcgttatcaacgctagggaggag
gagctagacaagatcatggagaagttcgaggattccgacgtctacactgtggacgcgacc
cagatcgcgctggacgagttaggtgtccctatcgtgaacaccgcgatggtcggtgcctat
ctgaaggcttccgatatcctcactctcgatgccgtgaagaaggccattcatgcacgcttc
tcgggagagatcgccgagaaaaacgtcagagccgttgaacgagcctaccgggaggtgaag
gcagttgggtaa

DBGET integrated database retrieval system