KEGG   Methanopyrus kandleri: MK0081Help
Entry
MK0081            CDS       T00078                                 

Gene name
PorD
Definition
pyruvate:ferredoxin oxidoreductase, delta subunit
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
mka  Methanopyrus kandleri
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mka00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MK0081 (PorD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MK0081 (PorD)
   00020 Citrate cycle (TCA cycle)
    MK0081 (PorD)
   00620 Pyruvate metabolism
    MK0081 (PorD)
   00640 Propanoate metabolism
    MK0081 (PorD)
   00650 Butanoate metabolism
    MK0081 (PorD)
  Energy metabolism
   00680 Methane metabolism
    MK0081 (PorD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MK0081 (PorD)
Enzymes [BR:mka01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MK0081 (PorD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
75485..75754
Genome map
AA seq 89 aa AA seqDB search
MGNEEFTIGAVVREPGSTKRNKTGRWRVFRPVLDQEKCMNCGLCFMYCPDGCIRPSDDGY
VIDYDYCKGCGICESVCPVNAIEMVLEEG
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
ttgggtaatgaagaatttacgataggggccgtagtgcgagagccgggaagtaccaagagg
aataagaccggcagatggcgcgtgttcaggcccgtactagatcaggagaagtgtatgaac
tgcggtctgtgcttcatgtactgcccggacgggtgcattaggccctcggacgatggctac
gttatcgactatgattactgtaaagggtgtggaatctgcgaaagcgtgtgtcctgtaaat
gcgatcgaaatggtactggaggagggttga

DBGET integrated database retrieval system