KEGG   Methanopyrus kandleri: MK0083Help
Entry
MK0083            CDS       T00078                                 

Gene name
PorB_1
Definition
pyruvate ferredoxin oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mka  Methanopyrus kandleri
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mka00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MK0083 (PorB_1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MK0083 (PorB_1)
   00020 Citrate cycle (TCA cycle)
    MK0083 (PorB_1)
   00620 Pyruvate metabolism
    MK0083 (PorB_1)
   00640 Propanoate metabolism
    MK0083 (PorB_1)
   00650 Butanoate metabolism
    MK0083 (PorB_1)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MK0083 (PorB_1)
   00680 Methane metabolism
    MK0083 (PorB_1)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MK0083 (PorB_1)
Enzymes [BR:mka01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MK0083 (PorB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
76931..77821
Genome map
AA seq 296 aa AA seqDB search
MGNKRRVPIPEEELMAPGHRACAGCGSALCARLCMKALGKDTVVVMPTGCIEVVTTPYPE
TAWEVPWIHVAFENAAAVASGIERALKALGKEDVTVAVLAGDGGTVDIGFQALSGMIERG
HNIVYICYDNEAYMNTGVQRSGATPYFAATTTTPPGKIWKGEMRPKKDIPKIIAAHGAPY
VATACVSHPQDLIKKVKKAKEVEGPAYVHVLCPCPPGWGHDSSETIEIAKLAVETGMWVL
YEIENGEFRITYRPKERKPVKEYLKRQKRFQHLSEDDIEKIQRMVDEQWKELEGKE
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtggggaacaagagacgcgtccccatcccggaggaggaactcatggctcccggccatcga
gcgtgtgcgggctgcggatccgccctctgcgcgcgcctctgcatgaaggccctcggtaaa
gacaccgtggtagtcatgccgacggggtgcatcgaggtcgtcacgacgccgtacccggag
accgcttgggaagtaccgtggatccacgtggcgttcgagaacgccgccgccgtcgcatcc
ggtatcgaacgcgcattgaaggcgttggggaaggaggacgtcaccgttgccgtgctcgcg
ggcgacggtggaaccgtggacataggatttcaggcgctatcgggaatgatcgagcgaggt
cacaatatcgtctacatctgttacgacaacgaggcttacatgaacacaggagtacagcgg
agcggtgcgacaccgtacttcgccgcgactaccacaacaccgccgggtaagatctggaag
ggagagatgcgacctaagaaggacatcccgaagatcatcgccgcgcacggagcgccgtac
gttgcgacggcgtgcgtatcccatccccaggacctcatcaagaaggtcaagaaggcgaag
gaagtggaaggaccggcgtacgtccacgtactgtgcccgtgtccaccgggttgggggcat
gattcgtcggagactatcgagatcgcgaagctggcagtggagacggggatgtgggtgcta
tacgaaatcgagaacggggagttccgcatcacctatcgtccgaaggagcgcaagccggtg
aaggagtacctcaagcgtcagaagcggttccaacacctgagcgaggacgacatagagaag
atccaaaggatggtggacgagcagtggaaggagctcgaagggaaggagtaa

DBGET integrated database retrieval system