KEGG   Methanopyrus kandleri: MK0192Help
Entry
MK0192            CDS       T00078                                 

Gene name
ChlI_ChlD
Definition
Mg-chelatase subunit ChlI/Chld
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mka  Methanopyrus kandleri
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mka00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(185064..187520)
Genome map
AA seq 818 aa AA seqDB search
MTVREVYEELREVVLEKLGKGEDPLPQILGQREVKIQVLSALIAGRHVLIEGPPGIGKTT
LARAVADLLPPAEVVKGCPFHCHPKEPVCPLCRARDEDELETETIPGCERFVRIQGSPDL
TPEDLLGDIDPIAALEYGPTDPRAFTPGKLLRGNRGVVFFDEINRCPEKLQNALLQVLEE
QRATIAGYEVDYPANFVMIATMNPHEYAGTEELSEVLLDRFDTVKMTYPKSKETEKRIVV
ERGEDFGVKVPEYVLEFIVDLVRATRDHDDIERPASVRATIGLYERAQTHAALQGRSKVE
LQDVIEVAPSVLRKRIKLSPRVQHVKSEEDVIKEIIQEVLEGYGKTEVPDTDGIPGKSKP
DEGASTGAPEGRRRSRRWRPRRTQEHPDGARLGSEKRSRSDSRTVSRSESQKTSATDSAA
DGEVLDDEYHRRLRFRALTKEDQRKYVEGEPEYVFAARVLRQLLNRGIEYIRPDQLAESL
VTSAAYVKGKYGRRFIEEITGWSYDEIASQQHDYSLIDELEEEIQRRLEILQKLGFVRPS
YQGGVSLTLKGRELAAFSALIEELEAFEGTEFGHHAAKRLSERGTGSRSYSREYRRGDPY
ANLDVRGSLRTAVRRGRREILPEDLRSFDREEEVCLDIVYVIDTSGSMSGDRIDAAKRAA
IALAHFSVKAGDRVGIVGFNTKAEIVVDITSDVEEIITKVMSLKPGGATDIGDAIRVGTE
LFRRCGRPDRDWHMILLTDGVPTKGEPDPETKALSEATAASRMGVTISTIGIKLPEEGIR
LIEHIAGISGGRSHHITDPEELTLVTLNEYRRAKGMGP
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
ttgactgtcagggaagtgtatgaggaactgcgcgaggtagtcctggagaagctcggtaaa
ggcgaggatcccctccctcagattctcgggcagagagaggtcaagatccaggttctctcc
gcgctcatcgccggacggcacgtgctcatcgagggtccgcccggcatcggcaagacgacc
ctcgctcgcgccgtcgcggacctcctacctcccgctgaggttgtgaaggggtgtcccttc
cactgtcatccgaaggagccggtatgtcccttgtgccgagctcgcgacgaggacgagctc
gagacggagaccattccagggtgtgagcggttcgtacggattcaggggagtcctgacctc
actccggaggatctgctcggagacatagatcccatcgcggccctcgagtacggaccgacc
gaccctcgggctttcactccagggaagctgctccgaggcaaccgtggcgtagtgttcttc
gacgagatcaaccgatgtcccgagaagctccagaacgcgctgctccaagtcttagaggag
cagcgtgctacgatcgcgggttacgaagttgactaccccgccaacttcgtcatgatcgcc
accatgaacccacacgaatacgcgggaaccgaggaactctccgaggttctcctagatcgc
tttgataccgtgaagatgacgtatcccaaatccaaggagaccgagaaacgcatcgtcgtc
gaacggggagaagacttcggagtgaaggtcccggagtacgtcctcgagttcatagtcgac
ctggttcgagccactcgagaccacgacgacatcgagaggcccgccagcgtccgcgccacc
atcggtttatacgagcgggcgcaaactcatgcggcgttgcaagggagatcgaaggtcgag
ctgcaggacgtcatcgaggtcgctccttcggtcctccgcaagcgcatcaagttgagtccg
agggtccaacacgttaaatcggaggaggacgtcatcaaagagatcatccaggaggtgctc
gagggatacgggaagaccgaagtgccggacacggacgggatcccgggaaagtcgaaaccc
gatgagggggcgtcgactggcgcccctgagggacgtcggagaagtcgccggtggaggccg
aggcgtactcaggaacatccggacggggcgaggcttggaagcgaaaagcgaagtcggtcg
gattctcgtacggtttcgaggagtgagagtcaaaagacctcagccaccgattcagccgcg
gatggtgaggttctggatgatgagtaccacaggaggttgcgattccgagccctcacgaag
gaggaccagcgcaaatacgtcgaaggggagccggagtacgtcttcgcggcccgcgtcctc
cgccaactgctcaaccggggtatagagtacatccgacccgatcagctggcggagtccctg
gttaccagtgcggcatacgtcaaggggaaatatggtcggaggttcatcgaggaaattacg
gggtggtcctacgacgaaatcgcctcacagcagcacgattactcgctcatagacgagcta
gaggaggaaatccagaggagactggagatccttcaaaaactagggttcgtgcgcccatct
taccaaggaggcgtgagcctgacactaaaaggtagagaactcgcggcgttttccgcgctg
atcgaggagctcgaagccttcgaaggcaccgagtttggacatcatgcggctaaacgtctg
agtgagcgaggcactgggagtaggagctactcccgagagtaccgtcgtggagatccctac
gcgaatctcgacgtacgtggatcactccggaccgccgttcgccgcggacgtcgcgagatc
cttcccgaagatctgcgctcgttcgacagggaggaggaggtatgtctcgatatcgtgtac
gtcatagacacctccggtagcatgtcgggagaccgcatcgacgctgctaagcgcgccgcg
atagctctcgctcacttcagcgtgaaggcgggggaccgagtaggtatcgtagggttcaac
actaaggcggagatcgttgtggacatcacgtcggatgtggaggagatcatcaccaaggtg
atgtcgctgaagcccggtggtgccacggacatcggcgatgcgatccgcgtaggcactgag
cttttcagacgctgtggaagaccagatcgggattggcacatgatcctactgacggacggg
gtacccaccaaaggggagcccgatccggagacgaaggcactatccgaagctaccgcagcg
agccgaatgggagtgacgatctctacgatcgggattaaactgcccgaggaaggtattcgg
ttgatcgaacacatcgccggaatctcaggcggccgctcgcaccacattaccgacccggaa
gagctcacgctggtgaccctcaacgagtaccgcagggccaaggggatggggccttga

DBGET integrated database retrieval system