KEGG   Methanopyrus kandleri: MK0192Help
Entry
MK0192            CDS       T00078                                 

Gene name
chlI_chlD
Definition
(GenBank) Mg-chelatase subunit ChlI and Chld (MoxR-like ATPase and vWF domain)
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mka  Methanopyrus kandleri
Pathway
mka00860  Porphyrin and chlorophyll metabolism
mka01100  Metabolic pathways
mka01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mka00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MK0192 (chlI_chlD)
Enzymes [BR:mka01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MK0192 (chlI_chlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_3 VWA AAA_5 VWA_2 Mg_chelatase Sigma54_activat VWA_3 VWA_CoxE AAA_PrkA MCM AAA RuvB_N AAA_2 AAA_16 CobT_C AAA_22 DUF58 NACHT TIP49 AAA_33 NTPase_1 ABC_tran AAA_28 AAA_18 AAA_11 AAA_30 AAA_29 AAA_24 AAA_19 TsaE
Motif
Other DBs
NCBI-ProteinID: AAM01409
UniProt: Q8TYU9
Position
complement(185064..187520)
Genome map
AA seq 818 aa AA seqDB search
MTVREVYEELREVVLEKLGKGEDPLPQILGQREVKIQVLSALIAGRHVLIEGPPGIGKTT
LARAVADLLPPAEVVKGCPFHCHPKEPVCPLCRARDEDELETETIPGCERFVRIQGSPDL
TPEDLLGDIDPIAALEYGPTDPRAFTPGKLLRGNRGVVFFDEINRCPEKLQNALLQVLEE
QRATIAGYEVDYPANFVMIATMNPHEYAGTEELSEVLLDRFDTVKMTYPKSKETEKRIVV
ERGEDFGVKVPEYVLEFIVDLVRATRDHDDIERPASVRATIGLYERAQTHAALQGRSKVE
LQDVIEVAPSVLRKRIKLSPRVQHVKSEEDVIKEIIQEVLEGYGKTEVPDTDGIPGKSKP
DEGASTGAPEGRRRSRRWRPRRTQEHPDGARLGSEKRSRSDSRTVSRSESQKTSATDSAA
DGEVLDDEYHRRLRFRALTKEDQRKYVEGEPEYVFAARVLRQLLNRGIEYIRPDQLAESL
VTSAAYVKGKYGRRFIEEITGWSYDEIASQQHDYSLIDELEEEIQRRLEILQKLGFVRPS
YQGGVSLTLKGRELAAFSALIEELEAFEGTEFGHHAAKRLSERGTGSRSYSREYRRGDPY
ANLDVRGSLRTAVRRGRREILPEDLRSFDREEEVCLDIVYVIDTSGSMSGDRIDAAKRAA
IALAHFSVKAGDRVGIVGFNTKAEIVVDITSDVEEIITKVMSLKPGGATDIGDAIRVGTE
LFRRCGRPDRDWHMILLTDGVPTKGEPDPETKALSEATAASRMGVTISTIGIKLPEEGIR
LIEHIAGISGGRSHHITDPEELTLVTLNEYRRAKGMGP
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
ttgactgtcagggaagtgtatgaggaactgcgcgaggtagtcctggagaagctcggtaaa
ggcgaggatcccctccctcagattctcgggcagagagaggtcaagatccaggttctctcc
gcgctcatcgccggacggcacgtgctcatcgagggtccgcccggcatcggcaagacgacc
ctcgctcgcgccgtcgcggacctcctacctcccgctgaggttgtgaaggggtgtcccttc
cactgtcatccgaaggagccggtatgtcccttgtgccgagctcgcgacgaggacgagctc
gagacggagaccattccagggtgtgagcggttcgtacggattcaggggagtcctgacctc
actccggaggatctgctcggagacatagatcccatcgcggccctcgagtacggaccgacc
gaccctcgggctttcactccagggaagctgctccgaggcaaccgtggcgtagtgttcttc
gacgagatcaaccgatgtcccgagaagctccagaacgcgctgctccaagtcttagaggag
cagcgtgctacgatcgcgggttacgaagttgactaccccgccaacttcgtcatgatcgcc
accatgaacccacacgaatacgcgggaaccgaggaactctccgaggttctcctagatcgc
tttgataccgtgaagatgacgtatcccaaatccaaggagaccgagaaacgcatcgtcgtc
gaacggggagaagacttcggagtgaaggtcccggagtacgtcctcgagttcatagtcgac
ctggttcgagccactcgagaccacgacgacatcgagaggcccgccagcgtccgcgccacc
atcggtttatacgagcgggcgcaaactcatgcggcgttgcaagggagatcgaaggtcgag
ctgcaggacgtcatcgaggtcgctccttcggtcctccgcaagcgcatcaagttgagtccg
agggtccaacacgttaaatcggaggaggacgtcatcaaagagatcatccaggaggtgctc
gagggatacgggaagaccgaagtgccggacacggacgggatcccgggaaagtcgaaaccc
gatgagggggcgtcgactggcgcccctgagggacgtcggagaagtcgccggtggaggccg
aggcgtactcaggaacatccggacggggcgaggcttggaagcgaaaagcgaagtcggtcg
gattctcgtacggtttcgaggagtgagagtcaaaagacctcagccaccgattcagccgcg
gatggtgaggttctggatgatgagtaccacaggaggttgcgattccgagccctcacgaag
gaggaccagcgcaaatacgtcgaaggggagccggagtacgtcttcgcggcccgcgtcctc
cgccaactgctcaaccggggtatagagtacatccgacccgatcagctggcggagtccctg
gttaccagtgcggcatacgtcaaggggaaatatggtcggaggttcatcgaggaaattacg
gggtggtcctacgacgaaatcgcctcacagcagcacgattactcgctcatagacgagcta
gaggaggaaatccagaggagactggagatccttcaaaaactagggttcgtgcgcccatct
taccaaggaggcgtgagcctgacactaaaaggtagagaactcgcggcgttttccgcgctg
atcgaggagctcgaagccttcgaaggcaccgagtttggacatcatgcggctaaacgtctg
agtgagcgaggcactgggagtaggagctactcccgagagtaccgtcgtggagatccctac
gcgaatctcgacgtacgtggatcactccggaccgccgttcgccgcggacgtcgcgagatc
cttcccgaagatctgcgctcgttcgacagggaggaggaggtatgtctcgatatcgtgtac
gtcatagacacctccggtagcatgtcgggagaccgcatcgacgctgctaagcgcgccgcg
atagctctcgctcacttcagcgtgaaggcgggggaccgagtaggtatcgtagggttcaac
actaaggcggagatcgttgtggacatcacgtcggatgtggaggagatcatcaccaaggtg
atgtcgctgaagcccggtggtgccacggacatcggcgatgcgatccgcgtaggcactgag
cttttcagacgctgtggaagaccagatcgggattggcacatgatcctactgacggacggg
gtacccaccaaaggggagcccgatccggagacgaaggcactatccgaagctaccgcagcg
agccgaatgggagtgacgatctctacgatcgggattaaactgcccgaggaaggtattcgg
ttgatcgaacacatcgccggaatctcaggcggccgctcgcaccacattaccgacccggaa
gagctcacgctggtgaccctcaacgagtaccgcagggccaaggggatggggccttga

DBGET integrated database retrieval system