KEGG   Methanopyrus kandleri: MK0282Help
Entry
MK0282            CDS       T00078                                 

Gene name
pcm
Definition
(GenBank) Protein-L-isoaspartate carboxylmethyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mka  Methanopyrus kandleri
Brite
Enzymes [BR:mka01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     MK0282 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 GCD14 Methyltransf_3 Methyltransf_25 Methyltr_RsmB-F Methyltransf_11 Ubie_methyltran MTS Methyltransf_24 Fibrillarin Met_10 DUF938 RrnaAD Methyltransf_23 Methyltransf_16 CMAS Methyltransf_18 Methyltransf_12 ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AAM01499
UniProt: Q8TYL4
Position
273412..274092
Genome map
AA seq 226 aa AA seqDB search
MAEDDKVFRRARERLVERLKSLGYIRSNRVAEAMLKVPRHEFVPEDLRDRAYVDSPLPIG
RGQTISAPHMVAIMTELLDPRPGHKVLEVGAGSGYHAAVVAELVKPDGRVITVERIPELA
DFARNNLKKTGYDRFVKVLVGDGTKGYPPEAPYDRILVTAGAPDVPESLLEQLKPGGKMV
IPVGDRHMQELWLVEKTEDGEIRRRRHGGCAFVPLIGEEGFQEPES
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
ttggccgaagacgataaggtctttcgacgcgcccgtgagcgcctggtggagcggttgaag
tccctgggttacattagatcgaaccgcgtggccgaggccatgctcaaggtgccgcgtcac
gagttcgttccggaggatctccgcgatcgggcctacgtcgactcgcccttacccatcggc
aggggacagaccatctcggccccgcacatggtggcgatcatgaccgagttgctcgaccca
cggcccggacacaaggtgctcgaggtgggggcgggttcggggtaccacgccgccgtggta
gccgaactggtgaaacccgacggtcgtgtgatcacggtcgagaggatcccggagctcgcg
gacttcgcccggaataacctgaagaaaaccggatacgaccgtttcgtgaaggtgttggtg
ggggacgggaccaagggctacccgcccgaagccccgtacgaccgtattctggtgacggcg
ggcgccccggacgtcccggaaagcctgctggagcagctgaaaccgggagggaagatggtc
attcctgtgggagaccggcacatgcaggagctgtggttggtggagaagaccgaggacgga
gagatcaggcgtcgtcggcacggtggatgcgcgttcgtaccgctcataggggaggagggg
ttccaggaacccgaatcttga

DBGET integrated database retrieval system