KEGG   Methanopyrus kandleri: MK0383Help
Entry
MK0383            CDS       T00078                                 

Definition
(GenBank) Predicted hydrolase related to cellulase M
Organism
mka  Methanopyrus kandleri
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(368062..369129)
Genome map
AA seq 355 aa AA seqDB search
MGTVETLTEHLRELVGRVAPPGWEDEVREYVEATLEKYCDDVHVDTLGNVIGTIEGSEYE
VMVAAHMDEVGFIVKSIDKNGFIRFAKLGGIDDRILPGSRVIIVNSEGEKVPGVVGTKPP
HIQEPKDRRKVPKHKDLFIDIGASDREEAEELVSVGDVGVLAGEFVELVGSRVNGRGLDD
KIGVAVLLALAERLADLDGDHPTFYLVGTVQEEVGLKGAKTSAFEVYPDGAVVLDTAVAG
DVPGVKEAELKLGKGPAITVVDASGRGLITHPKVRKLLIDTAEELDIPYQLEVGEGGTTD
ATAIHLTRGGVPTGVVGIPTRYLHSPAEVLDLEDAKHALELVVEVVQRFPDYVPR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccgtcgaaaccctcacggaacacctacgcgagctggtcggccgtgtggctcca
ccgggctgggaggacgaggtccgcgagtacgtggaggccacactggagaagtactgtgat
gatgtccacgtagataccttagggaacgtgatcggtactatcgaaggctccgagtacgag
gtgatggtagccgcccacatggacgaggtgggtttcatcgtcaagtccatcgacaagaac
gggttcatacggttcgcgaagctcggcggtatcgatgacaggatcttaccgggctcacgc
gtgatcatcgtgaactccgaaggcgaaaaggtgccgggggtcgtcgggaccaagcctccg
cacatccaggagccgaaggatcggcggaaagtgcccaagcacaaggacttgttcatagat
atcggcgcctcagacagggaggaggctgaggaactcgtgagcgtaggggatgtcggggtc
ctagccggagagttcgtagaactggtaggatcgagggtcaacggccgaggtctcgacgac
aagatcggtgtcgccgttcttctcgcgctggccgagcgtctcgccgacctcgacggagac
caccccacgttttacctggtgggaacagtccaggaggaggtgggtctgaagggggccaaa
acgtccgccttcgaggtctacccggacggtgctgtagttctagacactgccgtagccggt
gacgtgccgggagtgaaggaggcggagctgaagctcgggaaggggccggcgatcacggta
gtcgacgcgagtggtcggggtctgatcactcaccccaaggtgagaaagctactgatagac
accgcggaggagctggacatcccgtatcagctcgaggtaggtgagggaggcaccaccgac
gcgacggccattcacctaaccagaggtggcgttccgacaggtgtagtggggataccgacc
aggtacctacactcgccggcggaggtgctggatctcgaggatgcgaaacacgccctcgag
ctcgtagtcgaggtcgtgcaaaggttcccggattacgtgccgaggtga

DBGET integrated database retrieval system