KEGG   Methanopyrus kandleri: MK0403Help
Entry
MK0403            CDS       T00078                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mka  Methanopyrus kandleri
Pathway
mka00260  Glycine, serine and threonine metabolism
mka00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mka01100  Metabolic pathways
mka01110  Biosynthesis of secondary metabolites
mka01130  Biosynthesis of antibiotics
mka01230  Biosynthesis of amino acids
Module
mka_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mka00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MK0403 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MK0403 (trpA)
Enzymes [BR:mka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MK0403 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth NMO BtpA ThiG HMGL-like TMP-TENI IGPS PucR
Motif
Other DBs
NCBI-ProteinID: AAM01618
UniProt: Q8TYA2
Position
383306..384133
Genome map
AA seq 275 aa AA seqDB search
MSGLVLERIFEEAEGEGRGALIGYLTCGHPGLEETVSLARALRDGGVDILELGVPFSEPI
ADGPTIQKAVDEALRAGTTPWDCLEVAEEVSEFVPVVLLCYYNTLHANGFERYLSAAAEA
GVSGIIVADMPVEESDEVHSVARDLEIDVIYLVAPSTTDERLKKIGERASGFVYVISRYG
VTGARRDLSEDTLELVRWVRDHVDVPVAVGFGISERWHVEEVIAAGADGAIVGSAFIKEI
HRSEDIAEAEERVRELAKELVEGARDGYRRRSSSE
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgtccggtttggtcctagaaaggatcttcgaggaagctgaaggcgaaggacgtggtgcg
ttgatcgggtacttgacctgtggacacccaggactcgaagagaccgtctcactggctcgg
gcgcttcgtgatggaggtgtggatatcctggaactcggggttccgttctccgagcccatc
gccgacggtccgacgatacagaaggcggtagacgaggcgttacgagcgggcactacaccg
tgggactgcttagaggtcgcagaggaggtgtccgagttcgtccccgtcgtgctcctatgt
tactacaatacgctccacgccaacggatttgagcgatatctctcggcggcggcggaggcc
ggtgtctccggaatcatagtggcggacatgccggtcgaggaatccgacgaggtccactcc
gtcgctcgagatctcgagatcgacgtgatctacctggtagccccttccacgaccgatgag
cggctgaagaagataggggaaagagcctcagggttcgtgtacgtgatctccaggtacggc
gtcaccggagcccgacgggatctttccgaagataccctggagctcgttcgttgggtgcgt
gaccacgtcgacgtaccggtagccgtggggttcgggatctcggaacgttggcacgtggag
gaggtaatagccgcgggcgctgacggggcgatcgttggatcggcgttcatcaaggagata
caccggtccgaggacatagcggaagcggaagagcgggttagagagctcgcgaaggagttg
gtggagggtgcccgggacgggtaccgtcgaagatcatcctctgagtga

DBGET integrated database retrieval system