KEGG   Methanopyrus kandleri: MK0403Help
Entry
MK0403            CDS       T00078                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mka  Methanopyrus kandleri
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mka00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MK0403 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MK0403 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MK0403 (trpA)
Enzymes [BR:mka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MK0403 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
383306..384133
Genome map
AA seq 275 aa AA seqDB search
MSGLVLERIFEEAEGEGRGALIGYLTCGHPGLEETVSLARALRDGGVDILELGVPFSEPI
ADGPTIQKAVDEALRAGTTPWDCLEVAEEVSEFVPVVLLCYYNTLHANGFERYLSAAAEA
GVSGIIVADMPVEESDEVHSVARDLEIDVIYLVAPSTTDERLKKIGERASGFVYVISRYG
VTGARRDLSEDTLELVRWVRDHVDVPVAVGFGISERWHVEEVIAAGADGAIVGSAFIKEI
HRSEDIAEAEERVRELAKELVEGARDGYRRRSSSE
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgtccggtttggtcctagaaaggatcttcgaggaagctgaaggcgaaggacgtggtgcg
ttgatcgggtacttgacctgtggacacccaggactcgaagagaccgtctcactggctcgg
gcgcttcgtgatggaggtgtggatatcctggaactcggggttccgttctccgagcccatc
gccgacggtccgacgatacagaaggcggtagacgaggcgttacgagcgggcactacaccg
tgggactgcttagaggtcgcagaggaggtgtccgagttcgtccccgtcgtgctcctatgt
tactacaatacgctccacgccaacggatttgagcgatatctctcggcggcggcggaggcc
ggtgtctccggaatcatagtggcggacatgccggtcgaggaatccgacgaggtccactcc
gtcgctcgagatctcgagatcgacgtgatctacctggtagccccttccacgaccgatgag
cggctgaagaagataggggaaagagcctcagggttcgtgtacgtgatctccaggtacggc
gtcaccggagcccgacgggatctttccgaagataccctggagctcgttcgttgggtgcgt
gaccacgtcgacgtaccggtagccgtggggttcgggatctcggaacgttggcacgtggag
gaggtaatagccgcgggcgctgacggggcgatcgttggatcggcgttcatcaaggagata
caccggtccgaggacatagcggaagcggaagagcgggttagagagctcgcgaaggagttg
gtggagggtgcccgggacgggtaccgtcgaagatcatcctctgagtga

DBGET integrated database retrieval system