KEGG   Methanopyrus kandleri: MK0618Help
Entry
MK0618            CDS       T00078                                 

Gene name
gapA
Definition
(GenBank) Glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mka  Methanopyrus kandleri
Pathway
mka00010  Glycolysis / Gluconeogenesis
mka01100  Metabolic pathways
mka01110  Biosynthesis of secondary metabolites
mka01120  Microbial metabolism in diverse environments
mka01130  Biosynthesis of antibiotics
mka01200  Carbon metabolism
mka01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mka00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MK0618 (gapA)
Enzymes [BR:mka01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     MK0618 (gapA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N NAD_binding_3 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AAM01833
UniProt: P58839
Position
complement(575280..576332)
Genome map
AA seq 350 aa AA seqDB search
MADVSVLINGYGTIGKRVADAVDAQRDMEVLGVVKTSPDYLARLAVEEYGYPLFVPEDRV
ERFEDAGIETEGTVEDVVLNAEDYGLDVVVDCTPEGIGARNKETLYEKAGVKAIFQGGEE
AEVAEVSFVAQCNYEEALGADYVRCVSCNTTALCRTLGTLKEEFELGRVYVTIVRRAADP
HQVKKGPINAIAPNPVTVPSHHGPDVKTVMPDIDITTAAVKVPTTLMHMHVVRVELKEEV
TSDDVIDAFEEARRIWVVPHGEGLGSTAELIELGRDLGRKRYDLYEILVWEESINVEDGV
LYYMQAVHQEADVVPENVDAIRAMTELEEDPEASMDATDSALGVLNSPPL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
ttggccgacgttagcgtgttgatcaacgggtacggaaccatcggtaagagagtcgccgat
gccgtcgacgctcagcgtgacatggaagtactcggagtggtcaaaacgtcgccggattac
ctggcccggttggccgtcgaggagtacggttacccgctgttcgtgccggaagaccgcgtt
gagaggttcgaagatgcaggaatcgagaccgagggtaccgtggaagacgtggtgctgaac
gccgaggactacgggttggacgtcgtcgtggactgcacccccgaaggcatcggagcccgg
aacaaagagacgctatacgagaaagccggggttaaggcgatcttccaaggtggcgaggag
gcggaagtcgccgaggtgtcgttcgtcgcccaatgtaactacgaggaggccctgggggct
gactacgtccggtgtgtgtcgtgcaacaccacggccctgtgccgcacgctagggacgctg
aaggaggagttcgagctcgggcgtgtctacgtgacgatcgtacgtcgggcggccgacccg
caccaggtgaagaagggacctatcaacgccatcgcgccgaacccggtgacggtgccgtcc
caccacggaccggatgttaagaccgtgatgccggacatcgacattacgacagcggccgtg
aaggtgccgacgacgctcatgcacatgcacgttgtcagggtggagctgaaggaagaggtc
acgtcggacgacgtcatcgacgcgttcgaggaggcgagaaggatatgggtggtaccgcac
ggggaggggctcggttccacggccgagttaatcgagttgggacgtgacctcggtaggaag
cggtacgacctgtacgagatactggtttgggaagagtccatcaacgtggaggacggcgtg
ctctactacatgcaggccgtgcaccaggaggccgacgtcgtacccgagaacgtggacgct
atccgcgcgatgaccgagttggaggaggatccggaggcctccatggacgccacggacagc
gcactcggcgtgctcaactccccgccactataa

DBGET integrated database retrieval system