KEGG   Methanopyrus kandleri: MK0731Help
Entry
MK0731            CDS       T00078                                 

Gene name
SucC
Definition
succinyl-CoA synthetase beta subunit
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mka  Methanopyrus kandleri
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mka01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mka00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mka00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:mka00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
697284..698363
Genome map
AA seq 359 aa AA seqDB search
MIRLLEYQAKHLLKEAGVPIPEGDVARTSADAARIAAELGGPVAVKAQVPVGARGKAGGI
LFADDPEGARKAARKLLGSRIRGETVRKVLVEEKLDIAEEWYVSITLDRAKRRPVLLVSR
EGGVDIEEVPDEKIARRYLDPILGLRPFEAREAILEAGIPKEHLRDVEEVITSMYEVFES
YDAHLVEINPLVLTENGEVVAADAVVNLDEDAANIRHPEFAEETRDFPFVELDGDIGIIA
NGAGLTMATIDLVKDLGGKPANFLDVGGGAYPTLIRRAILTVAELDVKVILLNIFGGITR
CDEVAEGIVQALDDVDVPLVVRLVGTNEEEGHRILREHGVDVYTELKEAVERAVELAGA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgatcaggctgttggagtaccaggctaagcatctgctcaaggaggccggggtgccgatt
ccagaaggcgacgtcgcccgcacctcggcggacgcggcccggatcgccgccgaactcggg
ggaccggtggccgtcaaggcgcaggtgcccgtcggggcccgtggtaaagccgggggtatc
ctgttcgcggacgacccggaaggggccagaaaggccgcccggaagctgctcggctcgcgg
atccggggtgagaccgtcaggaaggtgctcgtggaagagaaactggacatagccgaggaa
tggtacgtgtccataacgctcgaccgtgcgaagcgtaggcccgtactcctcgtctcccgc
gaaggtggagtagatatcgaagaggttccggacgagaagatcgcccgcaggtacctcgac
ccgatcctaggattacgccccttcgaagctcgagaggcgatcctcgaggcgggtatcccg
aaggagcacctgcgggacgtcgaggaagtgatcacatccatgtacgaggtgttcgagagc
tacgacgctcacctcgtggagatcaacccgctagttcttacggagaacggggaggtagtg
gccgcggacgctgtcgtgaacctggacgaagacgccgccaatatccggcacccggagttc
gccgaagagacccgcgatttccccttcgtcgagctcgacggtgacatcggtatcatcgcc
aacggtgcgggtctcaccatggccaccatagatctcgttaaggatctcggtggtaagccc
gccaacttcttggacgtaggtggtggggcttacccgacgctcatccgtagagccatcctc
accgtggccgagctggacgtgaaagtgatcctcctcaacatcttcggtggcatcactcgg
tgtgacgaggtggcggaaggtatcgttcaagccctcgacgacgtggacgtcccgctcgtg
gtgaggctcgtggggacgaacgaggaggaaggtcatcgcatactccgcgagcacggggtc
gacgtctacaccgagcttaaggaggcggtcgaacgcgcggtcgagttagcgggggcttag

DBGET integrated database retrieval system