KEGG   Methanopyrus kandleri: MK0738Help
Entry
MK0738            CDS       T00078                                 

Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mka  Methanopyrus kandleri
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mka00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(702369..703142)
Genome map
AA seq 257 aa AA seqDB search
MWESRRKSEPRFPLSFSSDDVKSPDVAVVGLPRERVLPEYPTGQAEAPNAVRSAASTLDF
YDPEVGDPLEILTLVDEGNLRTFEPESEPEIFVVLGGDHSITPEIVQELTPRRLLWLDAH
PDLRRSERHDGALRGCLEIVDEVFLVGVRCWSREEYDVFREHEHVVSVDHGDITEVIDDV
DYVSLDLDVLDPSVVPGVTTPEPGGLPYRLCADILRWAGRKRAHLDVVELCPTVESHVSP
VTAARLVGEYLKGVAER
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
ttgtgggaatcaaggaggaagagtgaaccccgcttcccactctcgttttcatccgacgac
gtgaaatccccggatgtagccgtagtcggacttcccagggagcgtgtgctcccagagtac
ccgaccggacaagccgaggctccgaacgccgtgaggtcggcggcttccaccctggacttt
tacgacccggaggtcggtgacccgctggaaatcctgaccctggtagatgaggggaacctc
aggacgttcgagcctgaaagcgagcccgagatattcgtggtgctcggcggcgatcactct
atcacgcccgaaatcgttcaagaactcaccccacggcgtttgctctggctggacgcgcac
ccggacctccgtagatccgaacgtcacgacggggccctacggggctgcctggagatcgtc
gacgaggtgttcttggtaggcgtcaggtgttggtcccgggaagagtacgacgtgttccgc
gagcacgagcacgtggtctccgtcgatcacggagatataaccgaggtaatcgacgacgtg
gactacgtgtcgctagacctcgacgtcctggatccgtccgtagtcccgggtgtaaccact
ccagaaccggggggactcccgtaccgcctctgcgccgacatcttgagatgggccggtcgg
aagcgtgctcacctagatgtagtcgagctctgtcccacggtcgaaagccacgtgtcgccg
gtgacggccgcccgcttggtgggcgaatacctcaagggagtggctgaaaggtga

DBGET integrated database retrieval system