KEGG   Methanopyrus kandleri: MK0784Help
Entry
MK0784            CDS       T00078                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mka  Methanopyrus kandleri
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mka00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MK0784 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MK0784 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MK0784 (trpB)
Enzymes [BR:mka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MK0784 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
745708..746904
Genome map
AA seq 398 aa AA seqDB search
MDRYPDENGYFGEYGGRFVPETLMPALEELEDAFKEAREDPEFWEELEELWRKYAGRPTP
LYYARNLSRKLGVKVYLKREDLVHGGAHKLNNTLGQALLADRMGKDRIIAETGAGQHGLA
TAMAGAALGKKVEIYMGAIDVERQKHNVFRMELMGAKVHPVKAGTQTLKDAINEALRDWI
TNLETTHYLLGSVVGPHPYPWIVREFQRVIGRETKEQITELEGGLPDAIVACTGGGSNSI
GIFYDFLDDEEVALYAVEAGGKGLDTDEHSASLCAGEVGVLHGCRTKVLQDEHGQIRPTH
SIAPGLDYPGVGPELAFLVDEGRVTADAVTDEEALRGFVMLNETEGILPALESAHAVYYV
KKLVERGELDRGDVVVVNLSGRGDKDVRIAAEELGVEI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtggataggtacccggacgagaacgggtatttcggtgagtacggagggcgtttcgtgccg
gagacgctcatgcccgcgctggaggaactagaggatgcgttcaaagaagcacgtgaagac
ccagagttctgggaagaactcgaagaactgtggcggaagtacgccgggcgcccgactcca
ctgtactacgcacggaacctgtcgcggaaactcggcgtcaaggtgtacctcaagcgcgag
gacttggtccacggcggggcacacaagctgaacaacacactcggtcaggccctgctcgcc
gatcgtatgggtaaagatcgcatcatcgcggagaccggtgccggacaacacggactcgcc
accgccatggccggggccgcactgggcaagaaagtcgagatctacatgggggccatcgac
gtagagcgccagaaacacaacgtcttcaggatggagctgatgggggccaaagtccacccc
gtgaaagccggaacgcagacgctcaaggacgcgatcaacgaggcgctgcgcgactggata
acgaacctcgagactactcattacctcttgggttccgtcgtcgggccgcacccttacccg
tggatcgtccgcgagtttcagcgggtgatcggcagggagacgaaggagcagatcacggag
ctagagggaggtcttccggacgcgatcgtggcgtgtacggggggaggcagtaactccatc
gggatattctacgacttcctggacgatgaggaagtagcgctatacgccgtcgaggccggt
ggcaaggggctggatactgacgaacattcggcctcgctgtgcgccggggaggtgggggtc
ctccacggttgtcggaccaaagtccttcaggatgagcacggccagatccgaccgacacac
agcatcgcacctggtctcgactatcctggagtgggtccggagctcgcgttcctagtggac
gaaggtagagtcaccgccgacgccgtgacggacgaggaagcactgcgtggtttcgtcatg
ctgaacgaaaccgaagggatactcccagcgctcgaatccgcacacgcggtctattacgtg
aaaaagctggtggaaagaggtgaactggaccgtggggacgttgtcgtcgtgaacctgtcg
gggagaggcgacaaggacgtaaggatagcggcggaggaattgggggtggagatctag

DBGET integrated database retrieval system