KEGG   Methanopyrus kandleri: MK0784Help
Entry
MK0784            CDS       T00078                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mka  Methanopyrus kandleri
Pathway
mka00260  Glycine, serine and threonine metabolism
mka00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mka01100  Metabolic pathways
mka01110  Biosynthesis of secondary metabolites
mka01130  Biosynthesis of antibiotics
mka01230  Biosynthesis of amino acids
Module
mka_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mka00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MK0784 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MK0784 (trpB)
Enzymes [BR:mka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MK0784 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP MAAL_N
Motif
Other DBs
NCBI-ProteinID: AAM01998
UniProt: Q8TX91
Position
745708..746904
Genome map
AA seq 398 aa AA seqDB search
MDRYPDENGYFGEYGGRFVPETLMPALEELEDAFKEAREDPEFWEELEELWRKYAGRPTP
LYYARNLSRKLGVKVYLKREDLVHGGAHKLNNTLGQALLADRMGKDRIIAETGAGQHGLA
TAMAGAALGKKVEIYMGAIDVERQKHNVFRMELMGAKVHPVKAGTQTLKDAINEALRDWI
TNLETTHYLLGSVVGPHPYPWIVREFQRVIGRETKEQITELEGGLPDAIVACTGGGSNSI
GIFYDFLDDEEVALYAVEAGGKGLDTDEHSASLCAGEVGVLHGCRTKVLQDEHGQIRPTH
SIAPGLDYPGVGPELAFLVDEGRVTADAVTDEEALRGFVMLNETEGILPALESAHAVYYV
KKLVERGELDRGDVVVVNLSGRGDKDVRIAAEELGVEI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtggataggtacccggacgagaacgggtatttcggtgagtacggagggcgtttcgtgccg
gagacgctcatgcccgcgctggaggaactagaggatgcgttcaaagaagcacgtgaagac
ccagagttctgggaagaactcgaagaactgtggcggaagtacgccgggcgcccgactcca
ctgtactacgcacggaacctgtcgcggaaactcggcgtcaaggtgtacctcaagcgcgag
gacttggtccacggcggggcacacaagctgaacaacacactcggtcaggccctgctcgcc
gatcgtatgggtaaagatcgcatcatcgcggagaccggtgccggacaacacggactcgcc
accgccatggccggggccgcactgggcaagaaagtcgagatctacatgggggccatcgac
gtagagcgccagaaacacaacgtcttcaggatggagctgatgggggccaaagtccacccc
gtgaaagccggaacgcagacgctcaaggacgcgatcaacgaggcgctgcgcgactggata
acgaacctcgagactactcattacctcttgggttccgtcgtcgggccgcacccttacccg
tggatcgtccgcgagtttcagcgggtgatcggcagggagacgaaggagcagatcacggag
ctagagggaggtcttccggacgcgatcgtggcgtgtacggggggaggcagtaactccatc
gggatattctacgacttcctggacgatgaggaagtagcgctatacgccgtcgaggccggt
ggcaaggggctggatactgacgaacattcggcctcgctgtgcgccggggaggtgggggtc
ctccacggttgtcggaccaaagtccttcaggatgagcacggccagatccgaccgacacac
agcatcgcacctggtctcgactatcctggagtgggtccggagctcgcgttcctagtggac
gaaggtagagtcaccgccgacgccgtgacggacgaggaagcactgcgtggtttcgtcatg
ctgaacgaaaccgaagggatactcccagcgctcgaatccgcacacgcggtctattacgtg
aaaaagctggtggaaagaggtgaactggaccgtggggacgttgtcgtcgtgaacctgtcg
gggagaggcgacaaggacgtaaggatagcggcggaggaattgggggtggagatctag

DBGET integrated database retrieval system