KEGG   Methanopyrus kandleri: MK0790Help
Entry
MK0790            CDS       T00078                                 

Gene name
PurL_1
Definition
phosphoribosylformylglycinamidine synthase I (EC:6.3.5.3)
Orthology
K01952  
phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
mka  Methanopyrus kandleri
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mka00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(750903..751583)
Genome map
AA seq 226 aa AA seqDB search
MVRVAVIRFPGTNCDLEMAWAVKLAGGDPEFVWHEDGGLDDFDAVIIPGGFTYGDYIRAG
AIAALSPILEEIRECAEDGRPVLGVCNGMQILAEAELIPGTLTVNVGNRFICDWVYLRVE
RTDTPFTTKYQEDEVIRVPIAHAEGRYYYENPEEIEDNVVFRFCGPDGDVSEEYNLNGSV
GGITGVVNDDGNVLGMMPHPERAAHRLLNSDDGLRLFESLVEWCRS
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
ttggtccgtgtggctgtcatcaggtttcccggcacgaactgcgacctcgagatggcatgg
gccgtgaagctcgctggtggagatccggagttcgtctggcacgaagatggtgggttagac
gacttcgacgccgtgatcatcccgggcggattcacttacggggattacatccgggcgggc
gccatcgccgcgctatccccgattttggaggagattcgagagtgtgcagaggacgggcgc
cccgtgctgggagtgtgtaacggaatgcagatactagccgaagcggagctcatcccgggt
actctcacggtcaacgtcgggaacaggttcatctgcgattgggtctacttacgcgtggaa
cgtactgacaccccgttcacgaccaagtaccaggaggacgaagtcattcgagttccgatc
gcccacgcggagggacggtactactacgaaaacccggaggagatcgaggacaacgtggtg
ttcaggttctgcggacccgacggcgacgtctcagaggagtacaacctcaacggctccgtc
ggcggtattacgggagttgtgaacgacgatgggaacgtcctcggaatgatgcctcaccct
gagcgcgcggctcaccgtctcctgaactccgatgacggtttacggttgttcgagtcgctc
gtcgagtggtgccgatcctga

DBGET integrated database retrieval system