KEGG   Methanopyrus kandleri: MK0920Help
Entry
MK0920            CDS       T00078                                 

Gene name
CpsG_2
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mka  Methanopyrus kandleri
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mka00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MK0920 (CpsG_2)
   00030 Pentose phosphate pathway
    MK0920 (CpsG_2)
   00051 Fructose and mannose metabolism
    MK0920 (CpsG_2)
   00052 Galactose metabolism
    MK0920 (CpsG_2)
   00500 Starch and sucrose metabolism
    MK0920 (CpsG_2)
   00520 Amino sugar and nucleotide sugar metabolism
    MK0920 (CpsG_2)
  Nucleotide metabolism
   00230 Purine metabolism
    MK0920 (CpsG_2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MK0920 (CpsG_2)
Enzymes [BR:mka01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     MK0920 (CpsG_2)
    5.4.2.8  phosphomannomutase
     MK0920 (CpsG_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
876957..878327
Genome map
AA seq 456 aa AA seqDB search
MGKLFGTFGVRGVVGEDLTEDVARRLGLAFGTYLGGDAEVLVGGDTRTSTDTLKDALISG
LTAAGCDVVDVGIAPTPAVQYLVDAEGFDAGAVVTASHNPPEFNGIKLLGSDGCGLSRED
EQEIERIYFEENPDRASWDRVGNRVSAPDLLLNFEEAVLDYVGDFDGEGLRVVVDAANGA
ASSVTPRLLSELGVEVISVNAHPDGRFPGREPEPSEENLETTMNMVRAAGADFGLAHDGD
ADRLILITGDGEFVPGDYSLAIVAAWALDEGKGSQVVTPVSSSMCVQKVVEDRGGEVIWT
KVGEPVVVEELKRAEDPALGGEENGGIIYPDFHLSRNGIITALLICKLVAEVGSLDDLLA
EVPKYHLHKTGVECPDDLKPKVMERVESLVEEEELEDVLTIDGVKLFYEDGWVLVRPSGT
EPLIRVFGEARDRETAIRRVEHWKERVEEIVSELKG
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggggaagttgttcggcactttcggagtccggggtgttgtgggcgaggatctcactgag
gacgtcgcccgaaggttgggactcgcgttcggaacgtacctcggaggtgacgcggaagtc
ctcgtcggcggtgacacccggaccagcaccgacactctcaaggatgctctgatctcgggg
ctaaccgccgcgggctgcgacgtcgtcgatgtggggatcgcaccgactccggccgtgcag
tacctggtggacgccgaggggttcgacgccggcgccgtggtgacggcgtcgcacaacccg
cccgagttcaacggtatcaagctgttgggctcggacgggtgcggattgtccagggaagat
gagcaggaaatcgagaggatttacttcgaggagaacccggatcgggcctcgtgggatcgt
gtgggtaaccgggtttcggcgccggacctgctcctgaacttcgaggaggccgtactcgat
tacgtgggtgacttcgacggagagggtctgcgagtcgttgtcgacgcggcgaacggcgcg
gcgtcgtcggtcacgccgcgactcctctcggagctcggtgtcgaggtgatcagtgtcaac
gcacatccggacgggcggttccccggacgtgagcccgagccgtcggaggagaacctggag
actacgatgaacatggtgagagcggccggcgcggacttcgggttagcccacgacggggat
gctgatcgactgattctcatcacgggtgacggcgagttcgtccccggggactactcgctg
gcgatcgtggcggcgtgggcgctcgacgagggtaaggggagtcaggtagtcaccccggtc
agctcctcgatgtgcgtacagaaggtggtagaggaccgcggtggagaggtgatctggacg
aaggtgggagagcccgtcgtcgtggaggagctcaagcgggcggaggatcccgcactgggt
ggtgaggagaacggtggaataatctacccggacttccacctctcccggaacggaatcatc
accgccttgctgatctgtaagctggtcgccgaggtgggatcgctcgacgacctactggcc
gaggtgcccaagtaccacctgcacaagaccggtgtggagtgccccgacgatctcaagccg
aaggtcatggagcgtgtcgaatcgctggtcgaagaggaggagttggaggatgtcctgacg
atcgacggcgtgaagttgttctacgaggatggttgggtgctcgtacggccttcgggcacg
gagcctttgatcagggtcttcggagaagcgcgagatcgagagaccgccatcaggcgggtg
gagcactggaaggaacgcgtcgaggagatcgtctcggagctgaaggggtag

DBGET integrated database retrieval system