KEGG   Methanopyrus kandleri: MK0954Help
Entry
MK0954            CDS       T00078                                 

Definition
(GenBank) Uncharacterized conserved protein
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mka  Methanopyrus kandleri
Pathway
mka00010  Glycolysis / Gluconeogenesis
mka00030  Pentose phosphate pathway
mka00051  Fructose and mannose metabolism
mka00680  Methane metabolism
mka01100  Metabolic pathways
mka01110  Biosynthesis of secondary metabolites
mka01120  Microbial metabolism in diverse environments
mka01130  Biosynthesis of antibiotics
mka01200  Carbon metabolism
mka01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mka00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MK0954
   00030 Pentose phosphate pathway
    MK0954
   00051 Fructose and mannose metabolism
    MK0954
  Energy metabolism
   00680 Methane metabolism
    MK0954
Enzymes [BR:mka01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     MK0954
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MK0954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: AAM02167
UniProt: Q8TWS8
Position
complement(916066..917193)
Genome map
AA seq 375 aa AA seqDB search
MVSVAEEKVTVSVIKADVGGFPGHSEVHPDLLEACEGVLEDAVDEVIIDYYVTRCGDDID
LIMTHTRGEDDEKVHELAWNAFQEATKVAEDLKLYGAGQDLLSDAFSGNVRGLGPGAAEM
ELVERPSEPIIVFCCDKTEPSAFNLPLFRIFADPNNTAGLVLDPSMHDGFEFEVHDVIDQ
KKVILKCPEEMYDLLALIGQTQRYAIKRVYKKGDGDEAERIAAVTSTERLNLIAGEYVGK
DDPVAIVRCQSGFPAVGEVLEPFTFPHLVAGWMRGSHNGPLMPVSEEEAHPTRFDGPPRI
IALGFQLRNGELVGPQDLFADPAFDRAREIANEVADYIRRHGPFQPHLLSEEELEYTTLP
DVLKKLEDRFEDLEE
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtggtttcggtggccgaggagaaggtcaccgtgagcgtgatcaaggcggacgtgggaggt
ttcccgggtcactcggaggttcacccggatcttctggaggcctgtgagggagtcctcgaa
gatgccgtggatgaggtgatcatcgattactacgtgacgcggtgcggtgacgatatcgac
ctcatcatgacgcacacgcgtggtgaggacgacgagaaggtgcacgagctcgcgtggaac
gcgttccaggaggccacgaaggtcgcggaggacctgaagctgtacggcgccggtcaggac
ctgctgtccgacgcgttcagcggtaacgtgcgcgggctcggtcccggcgcggcggagatg
gagctggtggagcgtccgagcgagccgatcatcgtgttctgctgcgacaagaccgagccg
agcgcgttcaacctgcccctgttccggatcttcgcggacccgaacaacacggccggtctg
gtgctggatccgagcatgcacgacgggttcgagttcgaggttcacgacgttatcgaccag
aagaaggtcatcctgaagtgtcccgaggagatgtacgatctgctcgccctgatcggtcag
acccagcgctacgcgatcaagcgcgtgtacaagaagggagacggggacgaggccgagcgc
atcgcggccgtgacgagcacggagcggctgaacctgatcgctggcgagtacgtgggtaag
gacgacccggtcgccatcgtgcggtgccagagcgggttccccgccgtcggcgaggtgctc
gaaccgttcacgttcccgcacctcgtggccggatggatgaggggtagccacaacggtccg
ctgatgcccgtatcggaggaggaggcgcacccgacgaggttcgacggtccaccaaggatc
atagcgctcgggttccagctgaggaacggagagctggtcggcccgcaggacctgttcgcg
gaccccgcgttcgaccgggcgagggagatcgcgaacgaggtggcggactacatccggaga
cacggaccgttccagccgcacctgctgtccgaggaggagctggagtacacgacgctaccg
gacgtactgaagaagctcgaggacaggttcgaggatctagaggagtga

DBGET integrated database retrieval system