KEGG   Methanopyrus kandleri: MK0961Help
Entry
MK0961            CDS       T00078                                 

Gene name
SpeE
Definition
spermidine synthase
Orthology
K00797  
spermidine synthase [EC:2.5.1.16]
Organism
mka  Methanopyrus kandleri
Pathway
Cysteine and methionine metabolism
Arginine and proline metabolism
Glutathione metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mka00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MK0961 (SpeE)
   00330 Arginine and proline metabolism
    MK0961 (SpeE)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MK0961 (SpeE)
   00480 Glutathione metabolism
    MK0961 (SpeE)
Enzymes [BR:mka01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     MK0961 (SpeE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(922744..923442)
Genome map
AA seq 232 aa AA seqDB search
MGVGEVVDNIGRGLLSEDRRAREAAARYREWAESLDEEELFRYVRERTGGLGHGKEGFEV
GKMGLKGYVIAWPEQARGMVLEIGTGLGRTTWALLRWGDPELIVSVEVDPRMLAIALYRN
PVPEFSEALRDDRVKILLGDAVEVVPKLPRGFDHVVHDGGPCPGRNPRLFSPEFLRTIAE
KLKDEGTASVFAGRDPRWQDRIYRALSRLFLEVRAESFPDTPTVVFRCEGRR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgggggtaggagaggtggtcgataatatcggtcgcgggttactcagtgaagacaggaga
gcgcgtgaggccgccgcgcggtaccgggagtgggcggagtcgttggatgaggaggagctg
ttccgatacgtgagggaacggacgggaggattgggccacgggaaggaggggttcgaggtc
gggaaaatggggctcaaggggtacgtgatcgcgtggcccgagcaggctcgaggcatggtg
ctggagatcggtacgggattgggcagaaccacctgggcgctgttgaggtggggtgacccg
gaactgatcgtttcggtggaagtggatcctcgaatgctcgcgatcgcgttgtaccggaac
ccggtcccggagttctccgaagcgctcagggacgacagggtcaagatactactgggcgac
gccgtggaagtcgtgccgaaactcccgagaggtttcgatcatgtggttcacgacggggga
ccgtgtcctgggcgcaacccacggctgttctctcccgagttcctaaggacgatagccgag
aagctgaaggacgagggtacggcgtcggtgttcgcgggtcgagatccgcggtggcaggat
aggatataccgagccctcagtcggctctttctggaggtgagagcggaatctttcccggac
accccgaccgtggtgttccgatgtgagggacgccgttag

DBGET integrated database retrieval system