KEGG   Methanopyrus kandleri: MK0961Help
Entry
MK0961            CDS       T00078                                 

Gene name
SpeE
Definition
spermidine synthase
Orthology
K00797  
spermidine synthase [EC:2.5.1.16]
Organism
mka  Methanopyrus kandleri
Pathway
Cysteine and methionine metabolism
Arginine and proline metabolism
Glutathione metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:mka00270]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mka00330]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mka00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(922744..923442)
Genome map
AA seq 232 aa AA seqDB search
MGVGEVVDNIGRGLLSEDRRAREAAARYREWAESLDEEELFRYVRERTGGLGHGKEGFEV
GKMGLKGYVIAWPEQARGMVLEIGTGLGRTTWALLRWGDPELIVSVEVDPRMLAIALYRN
PVPEFSEALRDDRVKILLGDAVEVVPKLPRGFDHVVHDGGPCPGRNPRLFSPEFLRTIAE
KLKDEGTASVFAGRDPRWQDRIYRALSRLFLEVRAESFPDTPTVVFRCEGRR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgggggtaggagaggtggtcgataatatcggtcgcgggttactcagtgaagacaggaga
gcgcgtgaggccgccgcgcggtaccgggagtgggcggagtcgttggatgaggaggagctg
ttccgatacgtgagggaacggacgggaggattgggccacgggaaggaggggttcgaggtc
gggaaaatggggctcaaggggtacgtgatcgcgtggcccgagcaggctcgaggcatggtg
ctggagatcggtacgggattgggcagaaccacctgggcgctgttgaggtggggtgacccg
gaactgatcgtttcggtggaagtggatcctcgaatgctcgcgatcgcgttgtaccggaac
ccggtcccggagttctccgaagcgctcagggacgacagggtcaagatactactgggcgac
gccgtggaagtcgtgccgaaactcccgagaggtttcgatcatgtggttcacgacggggga
ccgtgtcctgggcgcaacccacggctgttctctcccgagttcctaaggacgatagccgag
aagctgaaggacgagggtacggcgtcggtgttcgcgggtcgagatccgcggtggcaggat
aggatataccgagccctcagtcggctctttctggaggtgagagcggaatctttcccggac
accccgaccgtggtgttccgatgtgagggacgccgttag

DBGET integrated database retrieval system