KEGG   Methanopyrus kandleri: MK0971Help
Entry
MK0971            CDS       T00078                                 

Definition
hypothetical protein
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mka  Methanopyrus kandleri
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:mka00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
930168..930926
Genome map
AA seq 252 aa AA seqDB search
MGGLPTLRIEPVPLERKVRPGDDLAELIAESAELEEGDVLAIAHTVVSKAEGALISLDEI
EPSPFAKTLAERTGKDPRVVEVILREAESIVRVGPDFIITEVRGGMVCANAGVDESNAPP
GYVIVLPEDPDRSARELRRRLRELVGVDVGVIITDTQGRPFREGVVGVAIGASGVPVLAD
RRGDRDLYGRELKITIVALGDLLASAAELVMGQADEGTPAVIFRGLKPELERFEGPRKAR
AIIRSPSRDIFR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggggggactccccacgcttcgcatcgagccggttccgctggagaggaaggtacgaccc
ggagacgacctcgcggagctcatcgcggagtccgcggagctcgaggagggggacgtcctc
gcgatcgctcacacggtagtatctaaggccgagggggccctaattagtctcgacgagatc
gagcccagtcccttcgctaagaccctcgccgagcggactggtaaagatccgcgtgtggtc
gaggtgatccttcgggaagcggagtccatcgtgcgggtcggtccggacttcatcatcacg
gaagtgcgaggagggatggtctgcgccaacgcaggcgtcgacgaatcgaacgcaccgccc
gggtacgtgatcgtcctgcccgaggatcccgatcgcagcgcccgagaactccgtcggcgt
ctccgcgaactcgtcggagttgacgtaggagtcatcatcaccgacactcaaggtcgacct
ttcagggaaggggttgtcggcgtagcgatcggggcctccggagtgcccgtactggccgac
cggcgtggggaccgcgatctctacggtcgcgagctgaaaatcacgatcgtagcgctcggt
gacctcctagcctccgcggcggagctcgtgatggggcaggccgacgagggtacgcctgcg
gtcatcttccgtgggctcaagcccgagcttgagcggttcgaaggtccccggaaggctcga
gcgattatccgctctccaagtagggatatattcagatga

DBGET integrated database retrieval system