KEGG   Methanopyrus kandleri: MK0974Help
Entry
MK0974            CDS       T00078                                 

Gene name
ThrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mka  Methanopyrus kandleri
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mka01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mka00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:mka00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
934272..935483
Genome map
AA seq 403 aa AA seqDB search
MHYVLECVECGSEFDDDSLVRCPECGGLLEVALRYDEIEVSRSTFEGRRLGVWAFRELLP
VNTDDPVTMSEGGTGLHPCPRLGEELGVRELFVKNEGENPTGSFKDRGMTVGVTKAVELG
AEVVACASTGNTSASLAAYAARAGLTCAVLLPAGKVALGKLAQALFHGARVIPVNGNFDD
ALDVVKKLADEGIVYILNSVNPFRLSGQRTIAYEICLQLDWEVPDAVVVPVGNAGNISAI
WQGFLDLYRLGIIDELPRMYGVQAEGARPIVEAIRRGKEDIEPDPEPETVATAIRIGNPV
NAIKALRAIRCSGGWAVEVSDEEILSAQRELATREGIFVEPASAASIAGLRKFVEEGEID
ADERVVCVTTGHGLKDPETVMEVCELPEPVEPDPETIQRLIAE
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttgcattacgtcctggagtgtgttgaatgcggttcggagttcgatgatgactcactggta
cggtgccccgagtgcggaggactcctggaggtggcactgcgctacgacgaaatcgaggtg
agtcggtcgacgttcgagggtcgtcgcctcggcgtatgggccttccgggagctcctacca
gtgaacacggacgatcccgtcacgatgtccgagggcggtacgggcttacacccgtgtccg
agactgggcgaggagctcggtgttagggagctgttcgtgaagaacgagggcgagaacccc
acgggctccttcaaggatcggggaatgaccgtgggagttaccaaggccgtggagctcggt
gcggaggtcgtcgcatgtgcctcgacgggcaacacatcggcctcgttggccgcctacgcc
gcccgcgcgggccttacgtgtgccgtcctccttccggccggtaaggtggccctaggcaaa
ctcgctcaagccctcttccacggtgcccgcgtgattccagtgaacggcaacttcgacgac
gccttggatgtcgtgaagaagctggccgatgagggcatcgtgtacattctaaactccgtg
aacccgttccgcctctccggtcagcgtaccatcgcgtacgagatctgcttgcagttggac
tgggaggtccccgacgcggtcgtcgtgccggtcggtaacgcgggtaacatcagcgcgatc
tggcaggggttcctcgatctctacaggctgggaatcatcgacgagctcccgaggatgtac
ggagtacaggcggagggtgctcgaccgatcgtcgaggcgattcggcggggcaaggaggac
atcgaaccggatcccgagcccgaaaccgtcgccaccgcgatccgcatcggtaacccagtg
aacgccatcaaggctctccgtgccatccggtgttcgggcggctgggccgtagaggtctcc
gacgaggaaatactctcggcgcagcgtgagctcgcaacgcgggaggggatcttcgtggag
ccggcgagtgccgcctcgatagcgggactcaggaagttcgtggaggagggtgagatcgac
gccgacgagcgggtggtctgcgtgaccaccggacacggtttgaaggatccggagacggtc
atggaagtgtgtgagctgcctgaacccgtggaaccggatcccgagaccatacagcgttta
atcgccgagtga

DBGET integrated database retrieval system