KEGG   Methanopyrus kandleri: MK0974Help
Entry
MK0974            CDS       T00078                                 

Gene name
ThrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mka  Methanopyrus kandleri
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mka00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MK0974 (ThrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MK0974 (ThrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MK0974 (ThrC)
Enzymes [BR:mka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MK0974 (ThrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
934272..935483
Genome map
AA seq 403 aa AA seqDB search
MHYVLECVECGSEFDDDSLVRCPECGGLLEVALRYDEIEVSRSTFEGRRLGVWAFRELLP
VNTDDPVTMSEGGTGLHPCPRLGEELGVRELFVKNEGENPTGSFKDRGMTVGVTKAVELG
AEVVACASTGNTSASLAAYAARAGLTCAVLLPAGKVALGKLAQALFHGARVIPVNGNFDD
ALDVVKKLADEGIVYILNSVNPFRLSGQRTIAYEICLQLDWEVPDAVVVPVGNAGNISAI
WQGFLDLYRLGIIDELPRMYGVQAEGARPIVEAIRRGKEDIEPDPEPETVATAIRIGNPV
NAIKALRAIRCSGGWAVEVSDEEILSAQRELATREGIFVEPASAASIAGLRKFVEEGEID
ADERVVCVTTGHGLKDPETVMEVCELPEPVEPDPETIQRLIAE
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttgcattacgtcctggagtgtgttgaatgcggttcggagttcgatgatgactcactggta
cggtgccccgagtgcggaggactcctggaggtggcactgcgctacgacgaaatcgaggtg
agtcggtcgacgttcgagggtcgtcgcctcggcgtatgggccttccgggagctcctacca
gtgaacacggacgatcccgtcacgatgtccgagggcggtacgggcttacacccgtgtccg
agactgggcgaggagctcggtgttagggagctgttcgtgaagaacgagggcgagaacccc
acgggctccttcaaggatcggggaatgaccgtgggagttaccaaggccgtggagctcggt
gcggaggtcgtcgcatgtgcctcgacgggcaacacatcggcctcgttggccgcctacgcc
gcccgcgcgggccttacgtgtgccgtcctccttccggccggtaaggtggccctaggcaaa
ctcgctcaagccctcttccacggtgcccgcgtgattccagtgaacggcaacttcgacgac
gccttggatgtcgtgaagaagctggccgatgagggcatcgtgtacattctaaactccgtg
aacccgttccgcctctccggtcagcgtaccatcgcgtacgagatctgcttgcagttggac
tgggaggtccccgacgcggtcgtcgtgccggtcggtaacgcgggtaacatcagcgcgatc
tggcaggggttcctcgatctctacaggctgggaatcatcgacgagctcccgaggatgtac
ggagtacaggcggagggtgctcgaccgatcgtcgaggcgattcggcggggcaaggaggac
atcgaaccggatcccgagcccgaaaccgtcgccaccgcgatccgcatcggtaacccagtg
aacgccatcaaggctctccgtgccatccggtgttcgggcggctgggccgtagaggtctcc
gacgaggaaatactctcggcgcagcgtgagctcgcaacgcgggaggggatcttcgtggag
ccggcgagtgccgcctcgatagcgggactcaggaagttcgtggaggagggtgagatcgac
gccgacgagcgggtggtctgcgtgaccaccggacacggtttgaaggatccggagacggtc
atggaagtgtgtgagctgcctgaacccgtggaaccggatcccgagaccatacagcgttta
atcgccgagtga

DBGET integrated database retrieval system