KEGG   Methanopyrus kandleri: MK1052Help
Entry
MK1052            CDS       T00078                                 

Gene name
ELP3
Definition
RNA polymerase II complex ELP3 subunit
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mka  Methanopyrus kandleri
Brite
Enzymes [BR:mka01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MK1052 (ELP3)
Transfer RNA biogenesis [BR:mka03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    MK1052 (ELP3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1018718..1020367)
Genome map
AA seq 549 aa AA seqDB search
MCCAPTVPENRTGVRDVSEADAFDMACRELVEKMLSGEIRTKGELQEAKREVCRKYGLSK
FPTDADVLERATPEEREKLREIVVKKPVRSISGVAVVAVMTKPYPCPHGRCAYCPGGPEK
GVPQSYTGKEPAGRRAKEHEFHPRKQVEARIRQLEISGHPTDKIELIVMGGTFPATPLCY
QEWFVRECLNAMTGKDALTIEEAQKYAETSERRPVGITFETRPDYCKEEHVDHMLKLGAT
RVEVGVQTIYDFILKRVDRGHTVKDTVEATRILKDAGLKVCYHIMPGLPGSNPERDLRML
KRLFKDPRFKPDMLKIYPCMVFEDTPLYDAWKRGEYEPYDEETAVKVIAEAKHRYVPEYC
RIMRVQRDIPAHLAAAGIRKTNLRQLVHDYLEEKGWECRCIRCREAGHRMRQGVEVDPGR
AELRIIKERTWKGGMDYFLAYEDPEADAILGYLRLRKPTELAHRPEIDPETAIVRELKVV
GPTVPIGERDTDAVQHRGLGERLMRKAEELAASELDADKIIVISAIGTREYYRKLGYERV
GPYMGKDLT
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgtgttgcgcccccacggtaccggagaaccgtacgggggtgagagatgtgtccgaggcc
gacgccttcgacatggcgtgccgcgaactcgtggagaagatgctgtcgggtgagatccga
actaaaggcgagctacaggaggccaagcgcgaggtctgcaggaaatacggtctttcgaag
ttccccacggacgcggacgtcctggaacgcgcaaccccggaggagcgcgagaaactccga
gagatcgtcgtgaagaaacccgtccgatcgatctcgggcgtggccgtcgtcgcggtgatg
acgaagccctatccgtgtccacatggccgttgtgcgtactgcccgggtggtcccgagaag
ggcgtaccacagagctacacgggtaaggagccggccggccgtcgggctaaggagcacgag
ttccacccacggaagcaggtcgaggcgcgcatacggcagctggagatctcgggtcacccc
accgacaagatcgagctgatcgtgatggggggtacgttccccgcgacaccgttgtgttac
caggagtggttcgtgcgggagtgtctgaacgcgatgaccgggaaggacgcgctcacgatc
gaggaggcgcagaagtacgcggaaacttcggaacgccgacccgtgggaatcaccttcgaa
acgcggcccgactactgcaaggaggagcatgtggaccacatgctcaagctgggcgccacc
agggttgaagtgggagtccagacgatctacgacttcatactgaagcgcgtggaccgcggt
cacaccgtgaaggataccgtcgaggcgacacgtatcctcaaggacgccggtctgaaagtg
tgttaccacatcatgcccggtctcccgggctcgaaccccgaacgcgacctcaggatgtta
aagcgactgttcaaggacccgcggttcaagccggatatgctgaagatctacccgtgtatg
gtcttcgaggatacgcccctatacgacgcgtggaaacgtggcgagtacgagccatacgac
gaggaaaccgcggtgaaagtcatcgccgaggcgaaacaccgctacgtaccggagtactgc
cgcatcatgcgggttcagcgggacatcccggcccacttggccgccgccggcatccggaag
acgaacctacgccagctcgtccacgattacctggaggagaaaggctgggagtgtcggtgt
atccgctgtcgggaggcgggtcacaggatgcgccaaggtgttgaggtggatccggggcga
gccgagctcaggatcatcaaagagcgtacgtggaaggggggcatggactacttcctggcg
tacgaggatccggaggcggacgctatactcggttatctgaggctcaggaagcccacggag
ctggcccacagaccggagatcgatcccgagacggccatcgtgcgcgagctgaaggtcgtc
ggaccgacggtgccgatcggcgagcgggacacggacgccgtccaacatcggggcctcggc
gagcggctgatgaggaaggcggaggagctcgccgccagcgagctggatgcggacaagatc
atcgtgatcagtgccatcgggacgcgcgagtactaccggaagctcgggtacgagcgcgtc
ggcccgtacatgggtaaggatttaacgtga

DBGET integrated database retrieval system