KEGG   Methanopyrus kandleri: MK1391Help
Entry
MK1391            CDS       T00078                                 

Gene name
TrpC
Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mka  Methanopyrus kandleri
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mka01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mka00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1417522..1418286
Genome map
AA seq 254 aa AA seqDB search
MDEILERVRERVEEIRDRTFTPRAGGRSLRKALSGPGVSVIAEVKPTSPSQGRLRDVDAE
DVAERARAYERGGAAGISVLTEPEFFDGRPEYVEVVREAVDVPVLRKDFIIDPVQVEESA
HYGADAVLIIAAAVGREAPELIDLAHEHGMEVLLEIDRWEHLELLSECDPDVVGVNNRDL
RTLEVDLNRTLELGPEVKDLTNAPLVAESGVSGPEDVVLLGEVADAVLVGTYLMRAPDPS
EAVRKLVEAGRSTE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
ctggacgagatcctggagcgcgtgagggaaagggttgaggagattcgcgaccgcacgttc
acgccgagagcgggaggaagatcgctacggaaggcactttcgggccccggcgtgtcggtg
atcgccgaggtgaaacccacctccccctcccagggcagactacgcgacgtggacgcggaa
gacgtcgccgagcgggcccgtgcgtacgagcgaggtggtgcggcgggtatctccgtgttg
accgagcccgagttcttcgacggtcggcctgagtacgtcgaggtcgtccgggaggccgtg
gacgttccggtactccgcaaggacttcataatcgacccggtgcaggtggaggagagcgcg
cactacggggccgacgccgtactgatcattgccgcggccgtaggtagagaggctcccgaa
ctaatcgatctggcacacgaacacggtatggaggttctactggagatcgaccgatgggag
cacctcgaactgctgagcgagtgcgatcccgacgtcgtaggggtgaacaaccgggacctc
cgcacgctcgaggtggacctgaaccggacgctcgagctgggtcccgaggttaaagacctc
acgaacgcccccctggtcgccgaatccggtgtttccggacccgaggacgtcgtcctgttg
ggtgaggtggccgacgcggtgctggtcggtacgtacctgatgcgtgcccccgacccgagc
gaagcggtaaggaagctcgtggaagcggggcggtcgacggagtga

DBGET integrated database retrieval system