KEGG   Methanopyrus kandleri: MK1550Help
Entry
MK1550            CDS       T00078                                 

Gene name
hemD
Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mka  Methanopyrus kandleri
Pathway
mka00860  Porphyrin and chlorophyll metabolism
mka01100  Metabolic pathways
mka01110  Biosynthesis of secondary metabolites
mka01120  Microbial metabolism in diverse environments
Module
mka_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mka00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MK1550 (hemD)
Enzymes [BR:mka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MK1550 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Nitro_FeMo-Co
Motif
Other DBs
NCBI-ProteinID: AAM02763
UniProt: Q8TV50
Position
complement(1566513..1567199)
Genome map
AA seq 228 aa AA seqDB search
MRALVVRAPGLERETVQAFKKVDLDAEVVCPVELVSLDRPKISAGLLSEYDAVAFTSPRT
VEFLSEEEVKELRRSDVDIAAVGPRTREALERAGLRVDVMPTEYTTGKLAEELRQYGAVL
ALRSRRRTEDLRRTLESYGVKAEELEMYDLKPKRVEVNPRKFDVVCFLSAFTARCFLENV
DPTEIPEPVVSIGPVTTKELRRAGLKVVEAEEHTVEAVAKTALRVIEA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
ttgagggctctggtcgtcagggcaccgggtctcgagagggagacggttcaagccttcaag
aaggtcgacctagacgctgaagtcgtgtgtcctgtcgagctcgtatcgctggaccgtcct
aagataagtgccgggttactgtccgagtacgacgcggtagctttcaccagcccgcgcacc
gtcgagttcctttccgaggaagaggtgaaagaactacgacgctcggatgtcgatatagct
gccgtcggtcccagaacgcgcgaggcgctcgaacgagctggactgcgcgtagatgtgatg
cctaccgaatatacgaccggaaagttagccgaagaactccgtcaatacggtgccgtgttg
gcgctccgttccagacggaggacggaggacctgagaaggacgctcgagtcttacggggtc
aaggccgaggagttggagatgtacgacctcaaacccaaacgcgttgaggtgaacccgagg
aagttcgacgtggtatgcttcctgagcgcgttcaccgcgcggtgcttcctcgagaacgtg
gaccctactgaaattccggagccggtagtgagtataggtccggtcaccaccaaggagctc
cgaagagccggcttgaaggtcgtggaggccgaagaacacaccgtggaagccgtagcgaag
acggcgctccgggtaatcgaggcgtga

DBGET integrated database retrieval system