KEGG   Methanopyrus kandleri: MK1550Help
Entry
MK1550            CDS       T00078                                 

Gene name
HemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mka  Methanopyrus kandleri
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mka00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MK1550 (HemD)
Enzymes [BR:mka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MK1550 (HemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1566513..1567199)
Genome map
AA seq 228 aa AA seqDB search
MRALVVRAPGLERETVQAFKKVDLDAEVVCPVELVSLDRPKISAGLLSEYDAVAFTSPRT
VEFLSEEEVKELRRSDVDIAAVGPRTREALERAGLRVDVMPTEYTTGKLAEELRQYGAVL
ALRSRRRTEDLRRTLESYGVKAEELEMYDLKPKRVEVNPRKFDVVCFLSAFTARCFLENV
DPTEIPEPVVSIGPVTTKELRRAGLKVVEAEEHTVEAVAKTALRVIEA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
ttgagggctctggtcgtcagggcaccgggtctcgagagggagacggttcaagccttcaag
aaggtcgacctagacgctgaagtcgtgtgtcctgtcgagctcgtatcgctggaccgtcct
aagataagtgccgggttactgtccgagtacgacgcggtagctttcaccagcccgcgcacc
gtcgagttcctttccgaggaagaggtgaaagaactacgacgctcggatgtcgatatagct
gccgtcggtcccagaacgcgcgaggcgctcgaacgagctggactgcgcgtagatgtgatg
cctaccgaatatacgaccggaaagttagccgaagaactccgtcaatacggtgccgtgttg
gcgctccgttccagacggaggacggaggacctgagaaggacgctcgagtcttacggggtc
aaggccgaggagttggagatgtacgacctcaaacccaaacgcgttgaggtgaacccgagg
aagttcgacgtggtatgcttcctgagcgcgttcaccgcgcggtgcttcctcgagaacgtg
gaccctactgaaattccggagccggtagtgagtataggtccggtcaccaccaaggagctc
cgaagagccggcttgaaggtcgtggaggccgaagaacacaccgtggaagccgtagcgaag
acggcgctccgggtaatcgaggcgtga

DBGET integrated database retrieval system