KEGG   Methanopyrus kandleri: MK1585Help
Entry
MK1585            CDS       T00078                                 

Definition
epimerase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mka  Methanopyrus kandleri
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mka00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1597109..1597681
Genome map
AA seq 190 aa AA seqDB search
MKVPSSSLAGLRRTVAELCKEVHRAGLTIGGSGNVSVRSGRYVAVSPSGFRLSDVRPRHV
PIVDVEGREVLGTTKPTSELLMHLSLYREVGDGVVIHTHSPYLTALVHSGNRPPETEDLR
RSVGEIVWVEYQPPGSERLAEAVAKVARKPMVAALERHGGLVVADRPEAALRLAEALEEA
ARLAVLRPHP
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtaccttccagctcacttgcgggattgaggagaaccgtcgcagaactgtgtaag
gaggtacatcgggccggtcttacgataggaggatcagggaacgttagcgtgcgctctggt
cgctacgtagcggtatcgccctccgggttcagattatctgatgtgcgcccacggcacgtg
ccgatcgtcgacgtagagggtcgcgaggtcctggggaccacgaaacccacatcggaattg
ctcatgcacctatctctgtaccgagaagtcggtgatggggtcgtaattcacactcattca
ccgtacttgacggcactggttcactccgggaaccgtccgccggagacagaggatcttcgg
agatccgtcggagaaatcgtgtgggtggaataccagccgcccggaagcgagcgtctagct
gaagccgtggcgaaagtagcccgtaaacccatggtagccgcactggagcgtcatggcggt
ctcgtcgtcgcggatagacccgaagcggccttgagactcgcggaagccttagaggaggcg
gccaggctggccgtacttagacctcatccttaa

DBGET integrated database retrieval system