KEGG   Methanopyrus kandleri: MK1664Help
Entry
MK1664            CDS       T00078                                 

Gene name
TpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mka  Methanopyrus kandleri
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mka00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MK1664 (TpiA)
   01230 Biosynthesis of amino acids
    MK1664 (TpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MK1664 (TpiA)
   00051 Fructose and mannose metabolism
    MK1664 (TpiA)
   00562 Inositol phosphate metabolism
    MK1664 (TpiA)
Enzymes [BR:mka01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MK1664 (TpiA)
Exosome [BR:mka04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MK1664 (TpiA)
  Exosomal proteins of bladder cancer cells
   MK1664 (TpiA)
  Exosomal proteins of melanoma cells
   MK1664 (TpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1666501..1667181)
Genome map
AA seq 226 aa AA seqDB search
MLRVPPVIVNFKAYSEAVGENALRLARVAAEVSEETGVEVGICPPHVDLRDVVREVGDEV
TVLAQAVDAAEPGGRTGHVTPEMVVEAGADGTLLNHSERRMLLEDLKDVCRACINEGLLT
IVCASDALAARAAGALSPHAVAVEPPELIGTGTPVSKADPEVVERSVEVVKEVSEETAVL
CGAGITDGSDVRAAVELGADGVLVASGVVLADDPKEALLDLISGLE
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgtgtacctcctgttatcgtgaatttcaaggcgtactcggaagcggtcggtgag
aacgcactacgactggctcgagtggccgcggaagtgtcggaagaaaccggagtcgaggtc
gggatctgtcctcctcatgtcgacctgcgcgacgtggttagggaggtaggcgacgaagtc
acggtcctagcgcaggcagttgatgcggccgagcccggcgggaggaccgggcacgtgact
cccgagatggtggtcgaagccggcgccgacgggacgcttctgaaccactcggaacgccgg
atgctgttggaggatcttaaggacgtctgccgagcgtgcataaacgagggtctcctcacg
atcgtgtgtgcgagcgacgcgctcgccgcccgtgcggccggggccctctcgcctcacgcg
gtggccgtggagccgccggagctcatcggtacggggaccccggtgtcgaaggccgacccc
gaggtagtcgagcgatcggtcgaggtcgtgaaggaggtctcggaggagacggccgtactg
tgcggggccgggatcaccgatgggtccgatgtgcgtgccgccgtggaattgggtgctgat
ggcgtcttagtagcttctggagtggtattagcggacgatcctaaggaggcgttattagac
ctcatctccggcctagaatag

DBGET integrated database retrieval system