KEGG   Mycobacterium kansasii 824: LH54_09590Help
Entry
LH54_09590        CDS       T03653                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mki  Mycobacterium kansasii 824
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mki00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LH54_09590
   00630 Glyoxylate and dicarboxylate metabolism
    LH54_09590
   00640 Propanoate metabolism
    LH54_09590
   00650 Butanoate metabolism
    LH54_09590
  Lipid metabolism
   00071 Fatty acid degradation
    LH54_09590
   00072 Synthesis and degradation of ketone bodies
    LH54_09590
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LH54_09590
   00310 Lysine degradation
    LH54_09590
   00380 Tryptophan metabolism
    LH54_09590
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LH54_09590
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LH54_09590
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LH54_09590
Enzymes [BR:mki01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LH54_09590
Exosome [BR:mki04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LH54_09590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2158806..2160017)
Genome map
AA seq 403 aa AA seqDB search
MPEEAFIYEAIRTPRGKQKNGSLHEVKPLSLVVGLIEELRKRHPDLDENLISDVILGCVS
PVGDQGGDIARAAVLASGMPVTSGGVQLNRFCASGLEAVNTAAQKVRSGWDDLVLAGGVE
SMSRVPMGSDGGAMGLDPATNYDVMFVPQGIGADLIATIEGFSREDVDRYALRSQEKAAA
AWSGGYFAKSVVPVRDQNGLLILDHDEHMRPDTTMEGLAKLKPAFEGLAAMGGFDDVALQ
KYHSVEKINHVHTGGNSSGIVDGAALVMIGSEKAGQAQGLTPRARIVATATSGADPVIML
TGPTPASLKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLNIPDEKLNVNGGAIAMGHP
LGATGAMILGTMVDELERRNARRALVTLCIGGGMGVATVIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagaagcctttatctacgaggccatccgcaccccgcgtggcaagcagaagaac
ggatcgttgcacgaggtcaagcccttgagcctggtcgtaggcctgatcgaggagctgcgc
aagcgtcaccccgacctggacgagaacctgatcagcgacgtcatcctgggctgcgtttca
cccgtcggtgaccagggtggtgacattgcccgggccgcggtgctggcgtcgggcatgccg
gtcacctccggcggtgtgcagctcaaccggttctgcgcatcgggcctcgaggccgtcaac
accgccgcgcagaaggtgcgctccgggtgggacgacctggtgctggccggcggcgtcgag
tcgatgagccgcgttccgatgggctccgacggcggcgcgatggggctggaccccgccacc
aactacgacgtcatgtttgttccgcagggcatcggcgccgatctgatcgccaccatcgag
ggcttctcccgcgaagatgtcgaccgctacgcgttgcgcagccaggagaaggccgccgcc
gcgtggtcgggcggctacttcgccaagtcggtggttccggtccgtgaccagaacggcctg
ctgatcctcgaccacgacgagcacatgcggcccgacaccaccatggaaggtctggccaag
ctgaagccggccttcgagggcctggcggcgatgggtggtttcgacgacgtcgcgctgcag
aagtaccactcggtcgagaagatcaaccacgtgcacaccggcggcaactcctcggggatc
gtcgacggtgccgcactggtgatgatcggcagcgagaaggctgggcaagcgcagggcctc
accccgcgggcccgcatcgtggccaccgccaccagcggcgccgacccggtgatcatgctg
accggccccaccccggccagcctcaaggtgctcgaccgggccgggctgaccgtcgacgac
atcgacctgttcgagctcaacgaggcgttcgcgtcggtggtgctgaaattccagaaggat
ctgaacatccccgacgagaagctcaacgtcaacggcggcgccatcgcgatgggccacccg
ctgggtgctaccggcgcgatgatcctgggcaccatggtcgacgaactggagcgccgcaat
gcccgacgggcgctcgtcacgctatgtatcggcggcggcatgggcgtcgcgacggttatc
gagagggtttaa

DBGET integrated database retrieval system