KEGG   Mycobacterium sp. KMS: Mkms_0120Help
Entry
Mkms_0120         CDS       T00442                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mkms_0120
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mkms_0120
  Lipid metabolism
   00071 Fatty acid degradation
    Mkms_0120
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mkms_0120
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mkms_0120
   00626 Naphthalene degradation
    Mkms_0120
Enzymes [BR:mkm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mkms_0120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(133344..134456)
Genome map
AA seq 370 aa AA seqDB search
MTMTIRGAVLEEIGRPRPFTESAPLSVSELQLDPPGPDELLIRIEAAGLCHSDLSVVDGN
RVRPVPMLLGHEAAGIVEQIGPGGSDLEVGQRVVMTFLPRCGHCTACATGGLTPCEPGTA
ANSAGTLMHGDIRLHRDGQPVHHHLGVSGFATYAVVDRHSVVAVDADVPPVVASLLGCAV
LTGGGAVLNVGKPQPGQTVVVVGLGGVGMAAMITAMAHDGVDVVGIDQLEDKLDRARAMG
INAAYTPEEAAERGLKAAVVIEAVGHPSALETAIAHTAPGGRTITVGLPRPDARISVSPL
GFVAEGRSLIGSYLGSAVPARDIPRFVELWRSGRLPVETLVSSTISLDEINAGMDRLAEG
KAVRQVIEFD
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgacgatccgcggcgccgtcctcgaagagatcggccggccccgccctttcacc
gagtccgcgccgctgtccgtgtccgaactccagctcgatccgcccggccccgacgaactg
ctgatccggatcgaggccgcgggtctgtgccactcggatctctcggtcgtcgacggcaac
cgcgtgcggccggttccgatgctgctcggccacgaagccgccggcatcgtcgagcagatc
ggtccgggcggctccgacctcgaggtgggtcagcgggttgtgatgacgttcctgccgcgc
tgcggccactgcaccgcctgtgccaccggcggtctcaccccgtgcgaaccgggcaccgcg
gccaacagcgccggcaccctcatgcacggcgacatccggctgcaccgcgacggccaaccg
gtgcaccatcacctcggggtgtccggtttcgccacttacgccgtggtggaccggcattcg
gtggtcgccgtcgacgccgacgtcccaccggtcgtcgcgtcgctgctcggttgcgcggtc
ctcaccggcgggggcgcggtgctcaacgtcggcaaaccgcaacccggccagaccgtcgtc
gtggtcggcctcggcggcgtcgggatggccgcgatgatcaccgccatggcgcacgacggc
gtggacgtcgtcgggatcgaccagctggaggacaaactcgaccgagcccgcgcgatgggc
atcaacgccgcctacaccccggaggaggccgctgaacggggcctcaaggcagcggtggtc
atcgaagcggtcggccacccctccgcactcgagaccgcgatcgcgcacaccgctcctggt
ggccgcacgatcaccgtcggcctcccccgccccgatgcgcggatctcggtgtcgccgttg
ggtttcgtcgccgaaggccggtccctgatcggcagttacctcgggtcggcggtgccggcc
cgcgacatcccccggttcgtcgagctgtggcgctctggtcgtctcccggtggaaaccctg
gtgtcctcgacgatctcactcgacgagatcaatgccggtatggaccgcctggccgagggc
aaggccgtccgccaggtcatcgagttcgactag

DBGET integrated database retrieval system