KEGG   Mycobacterium sp. KMS: Mkms_0196Help
Entry
Mkms_0196         CDS       T00442                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mkms_0196
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mkms_0196
Enzymes [BR:mkm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Mkms_0196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(214433..216730)
Genome map
AA seq 765 aa AA seqDB search
MTTHAESKTGTSFDQEVAETQRYLDSPRFEGITRLYTARQVVEQRGTIPVDHTVAREAAT
AFYPRLRELFSQGKSITTFGPYSPGQAVTMKRAGIEGIYLGGWATSAKGSTDEDPGPDLA
SYPLSQVPDEAAGLVRALLTADRNQHYLRLRMSEEQRAAAPPPVDFRPFIIADADTGHGG
DPHVRNLIRRFVEAGVPGYHIEDQRPGTKKCGHQGGKVLVPSDEQIKRLNTARFQLDIMG
VPGIIVARTDAEAANLIDSRADERDQPFLLGATNLSIPSYKSCFLAMMRSFHDAGVTALN
GHLLYWLPDGEYETARAWLERHGIADVIAKAVEQWRSDGDPSNDALYDDVESQFIAAWEE
DAGLKTYAETVAARLEFAEGDGEAYAMGVDEWTQFAKRASLYTAGKKARELGVDVDWDCE
LAKTPEGYYQLRGGIPYAIAKQLAAAPFADILWMETKTADLADAREFAEAIHAEYPDKML
AYNLSPSFNWDTTGMTDDEMRAFPEELGKMGFVFNFITYGGHQVDGVASEEFATALRQDG
MLALARLQRKMRLVESPYRTPQTLVGGPRSDAALLASSGRTATTKAMGKGSTQHQHLVQT
EVPKKLLEDWLAMWSEHYQLGEKLRVQLRPRRAGGEVLELGIYGERDGGEEKLADVLVDP
IKDRYGRSILTVRDQNTYAEKLRKKRLMTLVHLWLVHRFKADAVYYVTPTDDNVYQTEKM
KSHGIFSDVHKDVGEIIVAEVNRARIEELLAPDREALGRLIRKED
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacccacgcggaatccaagaccggcacgtcattcgaccaagaggtcgccgagacg
cagcgctatctcgacagcccccggttcgagggcatcacccgcctctacacggcccgacag
gtcgtcgaacagcgcgggacgatccccgtcgaccacaccgtggcccgcgaggcggcgacg
gcgttctacccgcgccttcgcgaactgttctcccagggcaagagcatcacgacattcggc
ccctactcccccgggcaggccgtgaccatgaaacgagccggcatcgagggcatctacctg
ggcggctgggccacctccgccaaggggtccaccgacgaggaccccggtcccgatctggcc
agctatccgctcagccaggtgcccgacgaagccgccggtctggtgcgcgcactgctcacc
gccgaccgcaaccagcactacctccggctgcggatgagcgaggagcaacgggcggcagcg
ccgcctcccgtcgacttccggcctttcatcatcgccgacgccgacaccggtcacggtggt
gatccccacgtgcgcaacctgattcgacggttcgtcgaggccggcgtacccgggtaccac
atcgaggaccagcgccccggcaccaagaagtgcggacatcagggcggcaaggtcctggtg
ccgtcggacgagcagatcaaacgcctcaacaccgcgcggttccaactcgacatcatgggc
gtaccgggcatcatcgtcgcccgcaccgacgccgaggccgccaacctgatcgacagccgc
gccgacgaacgcgatcaacccttcctgctcggcgcgacgaatctgtccattccgtcgtac
aagtcgtgcttcctggcgatgatgcgcagcttccacgacgcgggcgtcaccgcactcaac
ggccacctgctctactggctgcccgacggcgagtacgagaccgcgcgcgcctggctggaa
cgccacggtatcgccgacgtcatcgccaaggccgtcgagcagtggcgttccgacggcgac
ccgagcaacgatgcgctctacgacgacgtcgaatcgcagttcatcgcggcctgggaggag
gacgccgggctgaagacctacgccgagacggtggccgcccgcctcgagttcgccgagggt
gacggcgaggcgtacgcgatgggcgtcgacgagtggacgcagttcgccaagcgggcatcg
ctgtacaccgccggcaagaaggccagggagttgggcgtcgacgtcgactgggactgcgag
ctggcgaagaccccggaggggtattaccaactgcgcggcggcattccgtacgcgatcgcc
aaacaactggccgccgcaccgttcgccgacatcctgtggatggagaccaagaccgccgac
ctcgccgacgccagggagttcgccgaggccatccacgccgagtaccccgacaagatgctc
gcctacaacttgtcgccgtcgttcaactgggacaccaccggtatgaccgatgacgagatg
cgggcgttccctgaggaactcggcaagatgggcttcgtcttcaacttcatcacctacggc
ggacaccaggtcgacggggtggcctccgaggagttcgccaccgccctgcggcaggacggc
atgctcgcgctggcccgtctgcagcgcaagatgcggctcgtcgaatcgccctaccgcaca
ccgcagacgctcgtcggcgggccgcgcagcgacgccgccctgctcgcctcgtccggccgc
accgccaccaccaaggcgatgggcaagggctccacacagcatcagcacctggtgcagacc
gaggtgcccaagaagctgctcgaggactggctcgcgatgtggagcgagcactatcagctg
ggcgagaagttgcgggtgcagttgcggccccggcgcgcgggcggtgaagtgctcgaactc
ggcatctacggcgagcgcgacggcggcgaggagaaactcgccgacgtgctggtcgacccg
atcaaggaccggtacggccgcagcatcctgacggtgcgcgaccagaacacctatgccgag
aagttgcgcaagaagcggctgatgacgctggtccacctgtggctggtgcaccgattcaag
gccgacgcggtgtactacgtgacaccgaccgacgacaacgtctaccagaccgagaagatg
aagtcgcacggcattttcagcgatgtgcacaaggacgtcggggagatcatcgttgccgag
gtcaaccgcgcgcgcatcgaggagctgctggcccccgaccgggaggcgctcggccggctg
atccgcaaggaagactga

  All links  
No link information was found.   
DBGET integrated database retrieval system