KEGG   Mycobacterium sp. KMS: Mkms_0196Help
Entry
Mkms_0196         CDS       T00442                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00630  Glyoxylate and dicarboxylate metabolism
mkm01100  Metabolic pathways
mkm01110  Biosynthesis of secondary metabolites
mkm01120  Microbial metabolism in diverse environments
mkm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mkms_0196
Enzymes [BR:mkm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Mkms_0196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABL89414
JGI: Mkms0196
UniProt: A1U9A6
Position
complement(214433..216730)
Genome map
AA seq 765 aa AA seqDB search
MTTHAESKTGTSFDQEVAETQRYLDSPRFEGITRLYTARQVVEQRGTIPVDHTVAREAAT
AFYPRLRELFSQGKSITTFGPYSPGQAVTMKRAGIEGIYLGGWATSAKGSTDEDPGPDLA
SYPLSQVPDEAAGLVRALLTADRNQHYLRLRMSEEQRAAAPPPVDFRPFIIADADTGHGG
DPHVRNLIRRFVEAGVPGYHIEDQRPGTKKCGHQGGKVLVPSDEQIKRLNTARFQLDIMG
VPGIIVARTDAEAANLIDSRADERDQPFLLGATNLSIPSYKSCFLAMMRSFHDAGVTALN
GHLLYWLPDGEYETARAWLERHGIADVIAKAVEQWRSDGDPSNDALYDDVESQFIAAWEE
DAGLKTYAETVAARLEFAEGDGEAYAMGVDEWTQFAKRASLYTAGKKARELGVDVDWDCE
LAKTPEGYYQLRGGIPYAIAKQLAAAPFADILWMETKTADLADAREFAEAIHAEYPDKML
AYNLSPSFNWDTTGMTDDEMRAFPEELGKMGFVFNFITYGGHQVDGVASEEFATALRQDG
MLALARLQRKMRLVESPYRTPQTLVGGPRSDAALLASSGRTATTKAMGKGSTQHQHLVQT
EVPKKLLEDWLAMWSEHYQLGEKLRVQLRPRRAGGEVLELGIYGERDGGEEKLADVLVDP
IKDRYGRSILTVRDQNTYAEKLRKKRLMTLVHLWLVHRFKADAVYYVTPTDDNVYQTEKM
KSHGIFSDVHKDVGEIIVAEVNRARIEELLAPDREALGRLIRKED
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacccacgcggaatccaagaccggcacgtcattcgaccaagaggtcgccgagacg
cagcgctatctcgacagcccccggttcgagggcatcacccgcctctacacggcccgacag
gtcgtcgaacagcgcgggacgatccccgtcgaccacaccgtggcccgcgaggcggcgacg
gcgttctacccgcgccttcgcgaactgttctcccagggcaagagcatcacgacattcggc
ccctactcccccgggcaggccgtgaccatgaaacgagccggcatcgagggcatctacctg
ggcggctgggccacctccgccaaggggtccaccgacgaggaccccggtcccgatctggcc
agctatccgctcagccaggtgcccgacgaagccgccggtctggtgcgcgcactgctcacc
gccgaccgcaaccagcactacctccggctgcggatgagcgaggagcaacgggcggcagcg
ccgcctcccgtcgacttccggcctttcatcatcgccgacgccgacaccggtcacggtggt
gatccccacgtgcgcaacctgattcgacggttcgtcgaggccggcgtacccgggtaccac
atcgaggaccagcgccccggcaccaagaagtgcggacatcagggcggcaaggtcctggtg
ccgtcggacgagcagatcaaacgcctcaacaccgcgcggttccaactcgacatcatgggc
gtaccgggcatcatcgtcgcccgcaccgacgccgaggccgccaacctgatcgacagccgc
gccgacgaacgcgatcaacccttcctgctcggcgcgacgaatctgtccattccgtcgtac
aagtcgtgcttcctggcgatgatgcgcagcttccacgacgcgggcgtcaccgcactcaac
ggccacctgctctactggctgcccgacggcgagtacgagaccgcgcgcgcctggctggaa
cgccacggtatcgccgacgtcatcgccaaggccgtcgagcagtggcgttccgacggcgac
ccgagcaacgatgcgctctacgacgacgtcgaatcgcagttcatcgcggcctgggaggag
gacgccgggctgaagacctacgccgagacggtggccgcccgcctcgagttcgccgagggt
gacggcgaggcgtacgcgatgggcgtcgacgagtggacgcagttcgccaagcgggcatcg
ctgtacaccgccggcaagaaggccagggagttgggcgtcgacgtcgactgggactgcgag
ctggcgaagaccccggaggggtattaccaactgcgcggcggcattccgtacgcgatcgcc
aaacaactggccgccgcaccgttcgccgacatcctgtggatggagaccaagaccgccgac
ctcgccgacgccagggagttcgccgaggccatccacgccgagtaccccgacaagatgctc
gcctacaacttgtcgccgtcgttcaactgggacaccaccggtatgaccgatgacgagatg
cgggcgttccctgaggaactcggcaagatgggcttcgtcttcaacttcatcacctacggc
ggacaccaggtcgacggggtggcctccgaggagttcgccaccgccctgcggcaggacggc
atgctcgcgctggcccgtctgcagcgcaagatgcggctcgtcgaatcgccctaccgcaca
ccgcagacgctcgtcggcgggccgcgcagcgacgccgccctgctcgcctcgtccggccgc
accgccaccaccaaggcgatgggcaagggctccacacagcatcagcacctggtgcagacc
gaggtgcccaagaagctgctcgaggactggctcgcgatgtggagcgagcactatcagctg
ggcgagaagttgcgggtgcagttgcggccccggcgcgcgggcggtgaagtgctcgaactc
ggcatctacggcgagcgcgacggcggcgaggagaaactcgccgacgtgctggtcgacccg
atcaaggaccggtacggccgcagcatcctgacggtgcgcgaccagaacacctatgccgag
aagttgcgcaagaagcggctgatgacgctggtccacctgtggctggtgcaccgattcaag
gccgacgcggtgtactacgtgacaccgaccgacgacaacgtctaccagaccgagaagatg
aagtcgcacggcattttcagcgatgtgcacaaggacgtcggggagatcatcgttgccgag
gtcaaccgcgcgcgcatcgaggagctgctggcccccgaccgggaggcgctcggccggctg
atccgcaaggaagactga

DBGET integrated database retrieval system