KEGG   Mycobacterium sp. KMS: Mkms_0239Help
Entry
Mkms_0239         CDS       T00442                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mkm  Mycobacterium sp. KMS
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mkm00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:mkm00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
261442..262647
Genome map
AA seq 401 aa AA seqDB search
MSEPMAWTRGLCALVATSGMLLACSSPKQEPAAAPADPAITAAPVSAAPAVPLKAPVPLA
PGAAACGQGAALLSEMTTRDKLAQLLMVGVSGAADARAVVDNHRIGGIMIGSWTDLSMMG
APLAEIAASAGPLPLAVSVDEEGGRVSRLASLIGSQPSARALAQSSTPDQVYGIALERGR
AMRGLGVTIDFAPVVDVTGASAAIGDRSFGDDPATVTEYAGAYARGLRDAGVLPVLKHFP
GHGNASGDSHTEGVVTPPLSELQNSDLVPYRTLTAQAPVGVMVGHMQVPGLTGSDPASLS
PAAYQLLRSGGYGGPGFNGPVFTDDISSMRAITDRYGVADAALRALQAGADTALWVTTAE
VPAVLDRLEQAVGSGELTMPRVDQSVLRVAAMKGPNPRCGG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagagcccatggcttggacccgaggactgtgtgcactggtcgcgacgtcgggaatg
ctgctcgcgtgctcgtcgccgaagcaggaacccgcggccgcaccggccgatccggcgatc
accgccgccccagtctccgccgcccccgccgttccgctgaaggccccggtgccgctggcg
cccggcgctgcggcatgcggtcagggcgccgcgttgctctcggagatgacgacccgcgac
aagctggcccagctgctgatggtcggcgtcagcggcgccgcggacgcccgcgcggtggtc
gacaaccaccgcatcggcggcatcatgatcggcagttggaccgacctgtcgatgatgggc
gccccgctggccgagatcgccgcctccgcgggcccgctgccgctggcggtcagcgtcgac
gaggagggcggccgggtctcccggctggcttcactgatcggcagccaaccgtcggcgcgg
gcgctggcccagagttcgacccccgaccaggtctacggcatcgcgctcgaacggggccgg
gcgatgcgcggtctcggcgtcacgatcgacttcgcgccggtcgtcgacgtcaccggggcc
agtgccgccatcggtgaccggtccttcggcgacgacccggcgacggtcaccgaatacgcc
ggggcgtacgcccgcgggctgcgcgacgccggggtgctgccggtgctcaaacacttcccg
ggccacggcaacgcctccggcgactcgcacaccgagggcgttgtcaccccgccgctgtcc
gagctgcagaactccgacctcgtgccgtaccgcacgctgaccgcgcaggcgccggtcggg
gtgatggtcggccacatgcaggtgccgggactgaccggaagcgatccggcgagcctgagc
ccggcggcctaccagctgctgcggtcgggcggctacggcgggccggggttcaacggtccg
gtcttcaccgacgacatctcgagcatgcgggcgatcaccgatcggtacggggtggccgat
gcggcgctgcgcgccctgcaggccggcgccgacaccgcgttgtgggtgacgacggccgag
gtgcccgcggtgctcgaccggctcgaacaggcggtgggctccggtgagctgacgatgccg
cgcgtcgaccagtcggtgctgcgggtggcggcgatgaagggcccgaacccgcgctgcggc
ggctga

DBGET integrated database retrieval system