KEGG   Mycobacterium sp. KMS: Mkms_0273Help
Entry
Mkms_0273         CDS       T00442                                 

Definition
bifunctional uroporphyrinogen-III synthetase/response regulator domain-containing protein (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mkms_0273
Enzymes [BR:mkm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mkms_0273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(310107..311255)
Genome map
AA seq 382 aa AA seqDB search
MSEPDWAPLTGFRVAVTSARRAEELSALLRRRGATVTSAAAIAMVPLPDDDELRAHTQAL
IDAPPDIVIATTGIGLRGWIAAADGWGVAAELTAALAGARIVSRGPKATGALRAAGLPEE
WSPDSESSREVLRYLLDGGIADKRIAVQLHGATDDWDPFPEFLDELRAAGADVVPIRVYR
WRPAPRDGDFDQLVAGIAEEKFDAVSFTSAPAVASVLMRATEMGVADRVLTALRTNVHAM
CVGPVTARPLVRLGVPTSAPERMRLGALARHITDELPLLQARTVRVAGHLLEIRGTCVLV
DGVVKSLSPAGMATIRALAHRPGAVVSRTDLLGALPGSGTDTHAVETAVLRLRTALGDKQ
IVSTVVKRGYRLTVDDDLAEAL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcctgactgggcaccgctcaccggattccgggtggcggtgacctccgcccga
cgcgccgaggagctgagcgcactgctgcgccgccgcggcgccaccgtcaccagcgcggcc
gcgatcgcgatggtgccgctacccgacgacgacgaactgcgcgcccacacccaggcactg
atcgacgcaccgcctgacatcgtgatcgcgaccaccgggatcgggctgcgcggctggatc
gccgccgccgacggctggggcgtcgccgccgaactcaccgcggccctggcgggggcccgc
atcgtctcccgcggacccaaggcgaccggcgcgctccgggccgccggcctgcccgaggag
tggtcaccggattcggagtcgtcccgggaggtgctgcgctatctgctcgacggcggcatc
gccgacaagcgcatcgccgtccagttgcacggcgccaccgacgactgggaccccttcccc
gaattcctcgacgaactgcgggccgcgggcgccgacgtggtgccgatccgggtgtaccgc
tggcgtccggcaccccgcgacggcgacttcgaccagttggtggcgggcatcgccgaggag
aagttcgatgccgtcagcttcacctccgcaccggctgtggcgtcggtgctcatgcgggcc
accgagatgggtgtcgccgaccgggtgctgacggccctgcggaccaacgtgcacgcgatg
tgcgtcggcccggtcaccgcgcgtcccctggtccggctcggggttccgacgtcggcgccg
gagcgcatgcggttgggtgcgctggcccgccacatcaccgacgaactgccactgttgcag
gcccgcaccgttcgggtggccggacacctgctcgagatccgcggtacctgcgtactcgtg
gacggtgtggtcaaatcgctgtccccggccgggatggccaccatccgcgcactcgcgcac
cggcccggcgcggtggtgtcgcgcaccgacctgcttggcgcattgcccggcagcggcacc
gacacccacgctgtcgagaccgcggtgctgcggctgcgaaccgcgttgggcgacaagcag
atcgtctccacggtcgtcaaacgcggataccggctcaccgtcgacgacgatctggcggag
gccctgtga

DBGET integrated database retrieval system