KEGG   Mycobacterium sp. KMS: Mkms_0273Help
Entry
Mkms_0273         CDS       T00442                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00860  Porphyrin and chlorophyll metabolism
mkm01100  Metabolic pathways
mkm01110  Biosynthesis of secondary metabolites
mkm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mkms_0273
Enzymes [BR:mkm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mkms_0273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: ABL89490
JGI: Mkms0273
UniProt: A1U9I2
Position
complement(310107..311255)
Genome map
AA seq 382 aa AA seqDB search
MSEPDWAPLTGFRVAVTSARRAEELSALLRRRGATVTSAAAIAMVPLPDDDELRAHTQAL
IDAPPDIVIATTGIGLRGWIAAADGWGVAAELTAALAGARIVSRGPKATGALRAAGLPEE
WSPDSESSREVLRYLLDGGIADKRIAVQLHGATDDWDPFPEFLDELRAAGADVVPIRVYR
WRPAPRDGDFDQLVAGIAEEKFDAVSFTSAPAVASVLMRATEMGVADRVLTALRTNVHAM
CVGPVTARPLVRLGVPTSAPERMRLGALARHITDELPLLQARTVRVAGHLLEIRGTCVLV
DGVVKSLSPAGMATIRALAHRPGAVVSRTDLLGALPGSGTDTHAVETAVLRLRTALGDKQ
IVSTVVKRGYRLTVDDDLAEAL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcctgactgggcaccgctcaccggattccgggtggcggtgacctccgcccga
cgcgccgaggagctgagcgcactgctgcgccgccgcggcgccaccgtcaccagcgcggcc
gcgatcgcgatggtgccgctacccgacgacgacgaactgcgcgcccacacccaggcactg
atcgacgcaccgcctgacatcgtgatcgcgaccaccgggatcgggctgcgcggctggatc
gccgccgccgacggctggggcgtcgccgccgaactcaccgcggccctggcgggggcccgc
atcgtctcccgcggacccaaggcgaccggcgcgctccgggccgccggcctgcccgaggag
tggtcaccggattcggagtcgtcccgggaggtgctgcgctatctgctcgacggcggcatc
gccgacaagcgcatcgccgtccagttgcacggcgccaccgacgactgggaccccttcccc
gaattcctcgacgaactgcgggccgcgggcgccgacgtggtgccgatccgggtgtaccgc
tggcgtccggcaccccgcgacggcgacttcgaccagttggtggcgggcatcgccgaggag
aagttcgatgccgtcagcttcacctccgcaccggctgtggcgtcggtgctcatgcgggcc
accgagatgggtgtcgccgaccgggtgctgacggccctgcggaccaacgtgcacgcgatg
tgcgtcggcccggtcaccgcgcgtcccctggtccggctcggggttccgacgtcggcgccg
gagcgcatgcggttgggtgcgctggcccgccacatcaccgacgaactgccactgttgcag
gcccgcaccgttcgggtggccggacacctgctcgagatccgcggtacctgcgtactcgtg
gacggtgtggtcaaatcgctgtccccggccgggatggccaccatccgcgcactcgcgcac
cggcccggcgcggtggtgtcgcgcaccgacctgcttggcgcattgcccggcagcggcacc
gacacccacgctgtcgagaccgcggtgctgcggctgcgaaccgcgttgggcgacaagcag
atcgtctccacggtcgtcaaacgcggataccggctcaccgtcgacgacgatctggcggag
gccctgtga

DBGET integrated database retrieval system