KEGG   Mycobacterium sp. KMS: Mkms_0649Help
Entry
Mkms_0649         CDS       T00442                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00630  Glyoxylate and dicarboxylate metabolism
mkm01100  Metabolic pathways
mkm01110  Biosynthesis of secondary metabolites
mkm01120  Microbial metabolism in diverse environments
mkm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mkms_0649
Enzymes [BR:mkm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Mkms_0649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABL89865
JGI: Mkms0649
UniProt: A1UAK7
Position
707041..708327
Genome map
AA seq 428 aa AA seqDB search
MSTVGKPKSPEEIQKDWDTNPRWKGITRDYSPADVVALQGSVVEEQTLARRGAEVLWNQL
HDMEFVNALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVPQV
VRRINNALLRADEIARVEGDTSVENWLVPIVADGEAGFGGALNVYELQKAMIAAGVAGSH
WEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVADVPTVVIARTDAEAATLITSD
VDERDQPFITGERTKEGFYRVKNGIEPCIARAKAYAPYSDLIWMETGTPDLELARKFAEG
VQAEFPDQMLAYNCSPSFNWKKHLDDATIAKFQKELGAMGFKFQFITLAGFHALNYSMFD
LAYGYARNQMTAYVELQEREFAAEERGYTATKHQREVGAGYFDRIATTVDPTSSTTALTG
STEEGQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgttggcaagccgaagtcccccgaagagatccagaaggactgggacaccaac
ccccgctggaagggcatcacccgcgattactccccggcagacgtcgtggccctgcagggc
tcggtcgtcgaggagcagacgctggcccgccgcggcgccgaggtgctgtggaaccagctg
cacgacatggagttcgtgaacgcgctcggcgcgctgaccggcaacatggccgtccagcag
gtccgcgccggcctgaaggccatctacctgtcgggttggcaggtcgccggtgatgcgaac
ctgtccggccacacctaccccgaccagagcctgtacccggccaactcggtgccccaggtc
gtccgccggatcaacaacgcgctgctgcgcgccgacgagatcgccagggtcgagggcgac
acctcggtcgagaactggctcgtgccgatcgtcgccgacggtgaggccggattcggtggc
gcgctcaacgtctacgagctgcagaaggcgatgatcgccgccggtgtcgcgggttcgcac
tgggaggaccagctggcctcggagaagaagtgcggccacctcggtggcaaggtgctgatc
ccgacccagcagcacatccgcacgctgacctcggcccgcctggccgccgacgtcgccgac
gtgccgaccgtcgtcatcgcccgcaccgacgccgaggccgccaccctgatcacctccgac
gtcgacgagcgcgatcagccgttcatcaccggtgagcggaccaaggaaggcttctaccgc
gtcaagaacggcatcgagccgtgcatcgcgcgcgccaaggcctacgcgccgtactcggat
ctgatctggatggagaccggcaccccggacctggagctggcccgcaagttcgccgagggc
gtgcaggcggagttcccggaccagatgctggcctacaactgctcgccgtcgttcaactgg
aagaagcatctcgacgacgcgacgatcgcgaagttccagaaggaactcggtgcgatgggc
ttcaagttccagttcatcacgctggccggcttccacgccctgaactactcgatgttcgat
ctggcctacggctacgcccgcaaccagatgaccgcgtacgtcgagctgcaggagcgcgag
ttcgccgccgaggagcgcggttacaccgcgacgaagcaccagcgcgaggtcggcgccggc
tacttcgaccggatcgccaccaccgtcgacccgaccagctcgaccaccgcgctgaccggt
tccaccgaagagggccagttccactaa

DBGET integrated database retrieval system