KEGG   Mycobacterium sp. KMS: Mkms_0672Help
Entry
Mkms_0672         CDS       T00442                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mkms_0672
   01230 Biosynthesis of amino acids
    Mkms_0672
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mkms_0672
  Energy metabolism
   00680 Methane metabolism
    Mkms_0672
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mkms_0672
Enzymes [BR:mkm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mkms_0672
Exosome [BR:mkm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mkms_0672
  Exosomal proteins of melanoma cells
   Mkms_0672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
727603..728349
Genome map
AA seq 248 aa AA seqDB search
MGDSTLILLRHGESEWNAKNLFTGWVDVDLTDKGRAEATRAGELIADLDRLPDVLYTSLL
RRAITTANIALDKADRHWIPVHRDWRLNERHYGALQGLNKAETKEKYGEEQFMAWRRSYD
TPPPPIEAGSEYSQDRDPRYADIDGGPLTECLADVVARFVPYFEQTIVPDLREGRTVLIA
AHGNSLRALVKYLDGMSDEDVVGLNIPTGIPLRYDLDSDLKPTVAGGTYLDPEAAAAGAA
AVASQGAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgggagattccacgctgatcctgcttcgtcacggcgaaagtgaatggaacgcgaagaac
ctgttcaccgggtgggtcgacgtcgacctgaccgacaagggccgggccgaggccacgcgg
gcgggtgagctgatcgccgatctggaccggttgcccgacgtgctgtacacctcgctgctg
cggcgcgcgatcaccacggccaacatcgcgttggacaaggcggaccggcactggatcccg
gtgcaccgggactggcggctcaacgagcggcactacggggcgctgcaggggctgaacaag
gccgagaccaaagagaagtacggcgaggagcagttcatggcctggcggcgcagctacgac
accccgccgccgccgatcgaggccggcagcgagtacagccaggaccgcgatccgcgctac
gccgacatcgacggcggaccgctcaccgaatgcctggccgacgtggtggcccgcttcgtg
ccctacttcgagcagacgatcgtgccggatctgcgcgagggcaggaccgtgctgatcgcc
gcgcacggcaactcactgcgtgcgctggtcaagtacctcgacggcatgtccgacgaggac
gtggtcgggctgaacatcccgaccggcataccgctgcgctacgacctggactccgatctg
aagccgacggtggcaggcggcacgtacctcgatccggaggccgcggcggccggcgcggcg
gccgtggcatcccagggcgcgaagtaa

DBGET integrated database retrieval system