KEGG   Mycobacterium sp. KMS: Mkms_0692Help
Entry
Mkms_0692         CDS       T00442                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mkm00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
744988..745959
Genome map
AA seq 323 aa AA seqDB search
MRQRPRRLRSTPAMRRLVAETSLEPRHLVLPMFVADGIDEPRPISSMPGVVQHTRDSLRR
AAADAVAAGVGGLMLFGVPRDEDKDPRGSIGMDPEGILNVALRDLAKDLGEDTVIMADTC
LDEFTDHGHCGVLDDRGRVDNDATNQQYVKLAVAQAQSGAHVVAPSGMMDGQVAAIRDGL
DGAGHTDVAILAYAAKFASAFYGPFREAVGSSLQGDRRTYQQDSGNAREALREIELDLAE
GADMVMVKPAMSYLDVVRACADISPVPVAAYQISGEYAMISAAAANGWIDLQASALEALT
GIRRAGADIVLTYWAADVAGWLG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcagcgtccgcgtaggttgcgttcgacaccggccatgcgtcggctggttgctgaa
acctccctggagccaaggcatctcgtgctgccgatgttcgtcgccgacgggatcgacgag
ccgcggccgatctcgtcgatgcccggggtggtgcaacacacccgcgactcgttgcgccgc
gcggccgccgacgcggtggccgccggggtgggcgggctgatgctgttcggggtgccccgc
gacgaggacaaggatccgcgcggttcgatcggcatggaccccgagggcatcctcaacgtc
gcgctgcgcgacctcgccaaggacctcggcgaggacaccgtgatcatggccgacacctgc
ctcgacgagttcaccgatcacggccactgcggggtgctggacgaccggggtcgggtcgac
aatgacgcgaccaatcagcagtacgtgaaacttgctgtggcccaggcgcagtcgggtgcc
cacgtggtcgcgccgagcgggatgatggacggtcaggtggccgccatccgcgacgggctg
gacggcgcaggacacaccgacgtggcgatcctggcgtatgcggccaagttcgcctcggcg
ttctacggcccgttccgcgaagccgtcggatcgagtctgcagggcgaccgccgcacctat
cagcaggacagcggcaacgcgcgcgaggctctgcgcgagatcgaactggacctcgccgag
ggcgccgacatggtgatggtgaagccggccatgtcctacctggacgtggtgcgcgcatgc
gccgacatctccccggtgccggtcgcggcgtaccagatctccggtgagtacgcgatgatc
agcgccgccgccgccaacggctggatcgatctgcaggcgtctgccctcgaagcgctcacc
ggtatccggcgggccggtgcggacatcgtgttgacctactgggcggccgacgtggccggc
tggctgggatga

DBGET integrated database retrieval system