KEGG   Mycobacterium sp. KMS: Mkms_0983Help
Entry
Mkms_0983         CDS       T00442                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mkms_0983
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mkms_0983
   00052 Galactose metabolism
    Mkms_0983
   00500 Starch and sucrose metabolism
    Mkms_0983
   00520 Amino sugar and nucleotide sugar metabolism
    Mkms_0983
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mkms_0983
   00524 Butirosin and neomycin biosynthesis
    Mkms_0983
Enzymes [BR:mkm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mkms_0983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1073523..1074431
Genome map
AA seq 302 aa AA seqDB search
MTDLTLALDIGGTKIAVGLVDADGTVVQRAQLPTPHSDAEAVWAVTSRLIAEAMSAGDGA
VRRAGIASAGPIDLPTGTVSPINLTVWQHFPIVSRVASLTGLPVRLGGDGLCMAMGERWR
GAARDAQFLLGMVVSTGVGGGLVLDGAPYDGRTGNAGHVGHVVVDPGGALCSCGGHGCVE
TVAAGPRMAQWARSQGWVAPPEADAKELADAALAGSEVALRAYARGARAVAAMIASVGAV
CDLDLVVIGGGVARSGALLFDPVRAALAEYAGLSFLRGLRVLPAELGGEAGLVGAAALAI
AG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctgacgctggccctggacatcggcggcacgaagatcgccgtcggactcgtc
gacgccgacggcaccgtcgtgcagcgggcccagctgcccacgccgcacagcgacgccgag
gcggtgtgggcggtgacctcccggctgatcgccgaggcgatgtccgccggtgacggtgcg
gtgcgacgcgcgggtatcgcctcggccgggccgatcgacctgccgaccggcaccgtcagt
ccgatcaatttgactgtgtggcaacactttccgatcgtctcgcgcgtcgcgtcgctgacc
ggtctgccggtgcgcctcggcggtgacgggctgtgcatggcgatgggtgagcggtggcgc
ggcgccgcgcgggatgcgcaattcctgctcggcatggtggtgtcgaccggggtcggcggc
gggctggtgctcgacggcgccccctacgacgggcgcaccggcaacgcggggcacgtcggg
cacgtcgtcgtcgacccgggcggtgcgctgtgttcgtgcggtggacacggctgtgtggag
accgtcgcggccggaccccggatggcgcagtgggcgcgctcgcagggatgggtcgccccg
cccgaggcggacgccaaggaactggccgacgccgcgctcgccggatccgaggtcgcgctg
cgggcgtacgcgcgcggtgcgcgggccgtggcggcgatgatcgcgtccgtcggcgcggtg
tgcgacctcgatctggtggtgatcggcgggggagtggcccggtcgggtgcgctgctgttc
gacccggtgcgggcggcgctggccgagtacgccgggctgagcttcctgcggggtctacgg
gtgctgcccgccgaactgggcggtgaggccgggctcgtcggcgccgcggcgctggcgatt
gccggatga

DBGET integrated database retrieval system