KEGG   Mycobacterium sp. KMS: Mkms_0984Help
Entry
Mkms_0984         CDS       T00442                                 

Gene name
rplJ
Definition
50S ribosomal protein L10
Orthology
K02864  
large subunit ribosomal protein L10
Organism
mkm  Mycobacterium sp. KMS
Pathway
Ribosome
Module
Ribosome, bacteria
Class
Genetic Information Processing; Translation; Ribosome [PATH:mkm03010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1074917..1075444
Genome map
AA seq 175 aa AA seqDB search
MAKADKATAVADIAEQFKEATATVVTEYRGLTVANLAQLRRSLGESATYTVAKNTLVKRA
AAEAGIDGLDELFTGPTAIAFVQGEPVDAAKAIKAFAKEHKALVIKGGYMEGRALSIDEV
NRIADLESREVLLAKLAGAMKGNLAKAAGLFNAPASQVARLAAALQEKKAGEEAA
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggctgacaaggccacggcggttgccgacattgccgagcagttcaaggaggcg
acggccaccgtcgtcaccgagtaccgcgggctgacggtggccaacctcgcgcagctgcgt
cgctcgctcggggaatccgccacctacaccgtcgcaaagaacacgctggtcaagcgcgcc
gctgccgaagcaggcatcgacggcctcgacgagctgttcaccggcccgaccgcgatcgcg
ttcgtccagggcgagccggtcgacgccgccaaggcgatcaaggctttcgccaaggagcac
aaggcgctcgtcatcaagggcggctacatggagggccgtgcgctctccatcgacgaggtc
aaccggatcgccgacctcgaatcccgcgaggttctgctggccaagctggccggcgcgatg
aagggcaacctcgccaaggccgccgggctgttcaacgccccggcgtcgcaggtcgcccgc
ctcgccgcggcgctgcaggagaagaaggccggcgaagaagccgcgtaa

DBGET integrated database retrieval system