KEGG   Mycobacterium sp. KMS: Mkms_0984Help
Entry
Mkms_0984         CDS       T00442                                 

Definition
(GenBank) LSU ribosomal protein L10P
  KO
K02864  
large subunit ribosomal protein L10
Organism
mkm  Mycobacterium sp. KMS
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Mkms_0984
Ribosome [BR:mkm03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Mkms_0984
  Bacteria
    Mkms_0984
  Archaea
    Mkms_0984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1074917..1075444
Genome map
AA seq 175 aa AA seqDB search
MAKADKATAVADIAEQFKEATATVVTEYRGLTVANLAQLRRSLGESATYTVAKNTLVKRA
AAEAGIDGLDELFTGPTAIAFVQGEPVDAAKAIKAFAKEHKALVIKGGYMEGRALSIDEV
NRIADLESREVLLAKLAGAMKGNLAKAAGLFNAPASQVARLAAALQEKKAGEEAA
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggctgacaaggccacggcggttgccgacattgccgagcagttcaaggaggcg
acggccaccgtcgtcaccgagtaccgcgggctgacggtggccaacctcgcgcagctgcgt
cgctcgctcggggaatccgccacctacaccgtcgcaaagaacacgctggtcaagcgcgcc
gctgccgaagcaggcatcgacggcctcgacgagctgttcaccggcccgaccgcgatcgcg
ttcgtccagggcgagccggtcgacgccgccaaggcgatcaaggctttcgccaaggagcac
aaggcgctcgtcatcaagggcggctacatggagggccgtgcgctctccatcgacgaggtc
aaccggatcgccgacctcgaatcccgcgaggttctgctggccaagctggccggcgcgatg
aagggcaacctcgccaaggccgccgggctgttcaacgccccggcgtcgcaggtcgcccgc
ctcgccgcggcgctgcaggagaagaaggccggcgaagaagccgcgtaa

DBGET integrated database retrieval system