KEGG   Mycobacterium sp. KMS: Mkms_1110Help
Entry
Mkms_1110         CDS       T00442                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00010  Glycolysis / Gluconeogenesis
mkm00020  Citrate cycle (TCA cycle)
mkm00620  Pyruvate metabolism
mkm01100  Metabolic pathways
mkm01110  Biosynthesis of secondary metabolites
mkm01120  Microbial metabolism in diverse environments
mkm01130  Biosynthesis of antibiotics
mkm01200  Carbon metabolism
Module
mkm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mkms_1110
   00020 Citrate cycle (TCA cycle)
    Mkms_1110
   00620 Pyruvate metabolism
    Mkms_1110
Enzymes [BR:mkm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mkms_1110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 Peptidase_M23 RnfC_N Ribosomal_S7 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ABL90323
JGI: Mkms1110
UniProt: A1UBW5
Position
1196615..1197814
Genome map
AA seq 399 aa AA seqDB search
MTEFRMPALGSDMDEGTLDQWLVKPGDTVTRGQVVAVVETTKAAVEVECWQEGTVDRLLV
PEGQTVRVGTPLATLLAPGETPAPTAPAVPRTMRESPVAVERPEGAGRPAPAAGPAIATR
PHRRWVSPAARRVAATLDIDADTLTGTGPQGAVTIRDVEQAAASRKQPADGRTVRDRSVA
MRASIAAAMSRSKREIPHYYLADEVLMDPALAWLAERNAARSITERVLPAVLQIKAVAAA
ADRFPEFNGFWRDDAFVGADGVHVGVAISLRGGGLVAPAIHDVPDRSLDDLMGALTDLVA
RARAGSLRSSEMSDPSITITNLGDQGVDTVFGVIYPPQVALVGFGKPVQRVCAVDGGIRI
ATALTATLAADHRASDGHRGALFLAAINEILQQPQKLEK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagttccggatgcccgcgctcggctcggacatggacgaggggaccctcgaccaa
tggctggtcaaaccgggcgacaccgtcaccaggggccaggtcgtggcggtggtcgagacc
accaaggccgccgtcgaggtcgaatgctggcaggaggggaccgtcgaccgcctcctggtg
cccgaaggccagaccgtccgggtcggaacgccgctggccacgctgctggctccgggcgaa
acacccgcaccgactgcaccggcggtgcctcgcacgatgcgggaatcgccggtggccgtc
gagagaccagaaggcgcaggcaggcctgctccggccgcggggccagccatcgcgacccgg
ccgcatcgccggtgggtctccccggcggcccgccgcgtggcagcgacgctggacatcgac
gccgataccctcaccggcaccggtccgcagggcgcggtcaccattcgcgacgtggaacag
gcggcagcgtcgaggaagcagccggccgacgggcgaaccgtacgggatcggtccgtggcg
atgcgcgcgtcgatcgccgcggcgatgagccggtcgaagcgcgagattccgcactactac
ctggccgacgaagtcctcatggacccggcgctggcatggctggctgagcgcaacgccgcg
cgatccatcaccgaacgggtgttgccggcggtgctgcagatcaaggccgtcgcggcggca
gcggaccgctttcccgagttcaacggcttctggcgcgacgacgcgttcgtcggtgccgac
ggcgtccacgtcggtgtcgccatctcacttcgcggtgggggcctggtcgcacccgcgatc
cacgacgtccccgacaggagcctcgacgacctcatgggggccctgaccgacctggtggcg
cgcgcccgggccggctcgctgcgcagttcggagatgtctgatccctccatcacgatcacc
aacctgggcgaccagggggtggacacggtgttcggcgtcatctatccgccacaggtcgcc
ctggtgggcttcggcaagccggtgcaacgggtatgtgccgtcgacggtggtattcgtatc
gcgaccgcgctgaccgccactctggcagcggatcaccgggccagcgatggacaccgcggt
gcgctcttcctcgccgcgatcaacgagatcctgcagcagccgcagaagttggagaagtga

DBGET integrated database retrieval system