KEGG   Mycobacterium sp. KMS: Mkms_1246Help
Entry
Mkms_1246         CDS       T00442                                 

Definition
succinate dehydrogenase subunit D (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mkm  Mycobacterium sp. KMS
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mkms_1246
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mkms_1246
   00650 Butanoate metabolism
    Mkms_1246
  Energy metabolism
   00190 Oxidative phosphorylation
    Mkms_1246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1332841..1333320)
Genome map
AA seq 159 aa AA seqDB search
MSPAENPYDHVTDRGGPAPVLQRSHDRPPSLDNPRAPKRAGGMPNFEKYAWLFMRFSGMV
LVFLALGHLFIMLMWDNGVYRIDFNYVAQRWSSPFWQTWDLLLLWLAQLHGGNGLRVIIS
DYARKDSTRFWLNSLLALSMIFILVLGTYVLLTFDANIS
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgagcccggcggagaacccctacgaccacgtcaccgaccgcggcggacccgcgccggtg
ctgcagcgcagccacgaccggccgccgagcctggacaacccgcgcgcacccaagcgtgcc
ggcggcatgccgaacttcgagaagtacgcatggctgttcatgcgcttctccgggatggtg
ctggtgttcctggcgctgggccacctgttcatcatgttgatgtgggacaacggcgtgtac
cgcatcgacttcaactacgtcgcgcagcggtggtcctcgccgttctggcagacctgggac
ctgctgctgctgtggctggcccagctgcacggcggcaacggcctgcgcgtgatcatctcg
gactacgcccgcaaggactccacgcggttctggctgaactcgctgctggcgctgtcgatg
atcttcatcctcgttctcggcacctacgtgctgttgacgttcgacgcgaacatctcgtaa

DBGET integrated database retrieval system